KEGG   Rattus norvegicus (rat): 140931Help
Entry
140931            CDS       T01003                                 

Gene name
Hnrnph1, Hnrph, Hnrph1
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein H1
  KO
K12898  heterogeneous nuclear ribonucleoprotein F/H
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    140931 (Hnrnph1)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    140931 (Hnrnph1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 zf-RNPHF
Motif
Other DBs
NCBI-GeneID: 140931
NCBI-ProteinID: NP_543172
RGD: 620840
Ensembl: ENSRNOG00000003399
UniProt: Q8VHV7
Position
10q22
AA seq 372 aa AA seqDB search
MGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSEEEIVQFFSGLEIV
PNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDP
PRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYNGYNDGYGFGS
DRFGRDLNYCFSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPVRV
HIETGPDGRVTGEADVEFATHEDAVAAMSKDKANMQHRYVELFLNSTAGASGGAYEHRYV
ELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVL
QENSSDFQSNIA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgggacacagatatgttgaagtattcaagtcaaacaacgttgaaatggattgggtgttg
aagcatactggtcccaatagtcctgacacggccaatgatggctttgtacggcttagagga
ctcccttttggatgtagcgaggaagaaattgttcagttcttctcagggttggaaatcgtg
ccaaatgggataacattgccggtggacttccaggggaggagtacgggggaggccttcgtg
cagtttgcttcacaggaaatagctgaaaaggctctaaagaaacacaaggaaagaataggg
cacaggtatattgaaatatttaagagcagtcgagctgaagttagaactcattatgatcca
ccacgaaaacttatggccatgcagcggccaggtccctatgacagacctggggctggcaga
gggtataacagcattggcagaggagctggctttgagaggatgaggcgtggtgcttatggt
ggaggctatggaggctatgatgattataatggctataatgatggctatggatttggttcg
gatagatttggaagagacctcaattattgtttttcaggaatgtctgaccacagatatggg
gatggtggctccactttccagagtacaacaggacactgtgtacacatgcggggattacca
tacagagctactgagaatgacatttataattttttttcaccactcaaccctgtgagagta
catattgagactggacctgatggcagagtaactggtgaagcagatgttgagtttgcaacc
catgaagatgctgttgcagctatgtcaaaagataaagcaaatatgcaacacagatatgta
gaactcttcttgaattctacagcaggagcaagcggtggtgcttacgaacacagatatgta
gaactcttcttgaattctacagcaggagcaagcggtggtgcttatggtagccaaatgatg
ggaggcatgggcttgtcaaaccagtccagttacggtggcccagccagccagcagctgagt
ggtggttatggaggtggctatggtggccagagcagcatgagcggatatgaccaagtttta
caggaaaactccagtgattttcaatcaaacattgcatag

DBGET integrated database retrieval system