KEGG   Rattus norvegicus (rat): 140932Help
Entry
140932            CDS       T01003                                 

Gene name
Bnip1, Bnip1l1
Definition
(RefSeq) BCL2/adenovirus E1B interacting protein 1
  KO
K08497  protein transport protein SEC20
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    140932 (Bnip1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    140932 (Bnip1)
Membrane trafficking [BR:rno04131]
 SNARE
  SNAP-25[N] (Qb)
   Sec20
    140932 (Bnip1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec20 DUF2777 Phage_GP20 DNA_methylase Sec34 DUF2856 Sec16 DUF883 ATG101
Motif
Other DBs
NCBI-GeneID: 140932
NCBI-ProteinID: NP_543173
RGD: 620799
Ensembl: ENSRNOG00000020753
UniProt: Q8VHI8
Position
10q12
AA seq 228 aa AA seqDB search
MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSELTELNTKVKEKFQQLKHRIQE
LEQSAKEQDKESEKQLLLQEVENHKKQMLSNQTSWRKANLTCKLAIDNLEKAELLQGGDS
LRQRKTTKESLAQTSSTITESLMGISRMMSQQVQQSEEAMQTLVSSSRTLLDANEEFKSM
SGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcggccccccaggatgtccacgtccgaatctgtaaccaggagattgtcaaattcgac
ctggaggtgaaggcacttatccaggatattcgagattgttccggacccttaagtgagctt
accgaactgaacactaaggtgaaagaaaagtttcaacagttaaaacacaggatccaggag
ctcgagcagtcagcaaaggagcaagacaaggagtcggagaagcagcttctacttcaggaa
gtggagaaccacaaaaagcagatgctcagcaaccagacctcatggcggaaagccaatctt
acctgcaagcttgccatcgacaacctggagaaagcagaacttctgcaaggaggagactcc
ttaaggcagaggaaaactaccaaagaaagtttggcccagacatccagcaccatcacagag
agtctcatggggatcagcaggatgatgtcacagcaggtgcagcagagtgaggaggctatg
cagactctagtcagctcttcacggactctcctggatgcaaacgaagagtttaagtccatg
tcaggaaccattcagttgggccggaagctcatcacaaaatacaaccgccgggaactaacg
gacaagcttctcatcttcctcgccctggccctgttccttgccacggtcctctatattgtg
aaaaagcgcctcttcccatttttgtaa

DBGET integrated database retrieval system