KEGG   Rattus norvegicus (rat): 140933Help
Entry
140933            CDS       T01003                                 

Gene name
Trpc5, Trrp5
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 5
  KO
K04968  transient receptor potential cation channel subfamily C member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    140933 (Trpc5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    140933 (Trpc5)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    140933 (Trpc5)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     140933 (Trpc5)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   140933 (Trpc5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans TRP_2 Ank_2 Ank_4 Ank_3 PKD_channel Ank
Motif
Other DBs
NCBI-GeneID: 140933
NCBI-ProteinID: NP_543174
RGD: 619787
Ensembl: ENSRNOG00000027233
UniProt: Q8VD38
Position
Xq34
AA seq 974 aa AA seqDB search
MAQLYYKKVNYSPYRDRIPLQIVRAETELSAEEKAFLSAVEKGDYATVKQALQEAEIYYN
VNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRK
PSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVE
CVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAE
YEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHSEELDPQKYHDLAKLKVAIKYHQKE
FVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFI
KKPFIKFICHTASYLTFLFMLLLASQHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIK
EMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRPREEWEMWHPTLIAEA
LFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYF
YYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFV
GATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPP
FNIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRHNLRSFTERHADSLIQNQHYQEVIRNL
VKRYVAAMIRNSKTNEGLTEENFKELKQDISSFRYEVLDLLGNRKHPRRSFSTSSAEFSQ
RDDTNDGSGGARAKSKSVSFNLGCKKKACQGAPLIRTMPRASGAQGKPKAESSGKRSFMG
PSFKKLGLLFSKFNGQTSEPTSEPMYTISDGIAQQHSMWQDIRYSQMEKGKAEACSQSEM
NLSEVELGEIRGAARSSECPLACSSSLHCASGICSSNSKLLDSSEDVFETWGEACDLLMH
KWGDGQEEQVTTRL
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctgtactacaagaaggtcaactactcaccatacagagaccgcatccccctc
caaatcgtgagggctgagactgagctgtctgctgaggagaaagctttccttagtgctgtg
gagaagggggactatgccaccgtgaagcaggcactgcaggaggccgagatctactacaat
gtcaacatcaactgcatggatcctttgggcaggagcgccctactcattgccattgagaat
gagaacttagagatcatggagctactgctgaaccacagtgtgtatgtgggcgatgcatta
ctctatgccatccgcaaggaggtggtaggagctgtggaacttctgctcagctacaggaag
ccaagtggagagaagcaggttcccactctgatgatggacacccagttctctgagttcaca
ccagacatcacacccatcatgttggcagcccacaccaacaactatgaaatcatcaaattg
cttgtccaaaagcgtgtcactatcccacggccccaccaaatccgctgcaactgtgtggag
tgtgtgtccagttcagaagtagacagcctacgtcattcaaggtcccgactgaacatatac
aaggcactggcaagcccttcgctcatcgccttatcaagtgaggaccctatcctcacagca
ttccggctgggctgggaactcaaggagctgagcaaggtggaaaatgagttcaaggctgag
tatgaggagctctcccaacagtgtaagctctttgccaaggacctgctggatcaagctcgg
agctcccgagaactggagatcattctcaaccatcgagatgaccacagcgaagaacttgac
ccacagaagtaccatgacctggccaagctgaaggtggcaatcaaatatcaccagaaagag
tttgtcgctcagccaaactgtcaacaattgctggccaccttgtggtacgatggcttccct
ggatggcgaagaaaacactgggtagtcaagcttctaacctgcatgaccattggattcctg
tttcctatgctgtccatagcctatctgatctcacccagaagcaaccttgggcttttcatc
aagaaaccctttatcaagttcatctgccacacagcatcctatctgaccttcctcttcatg
cttctcctggcttctcagcatattgtcagaacagacctccatgttcaaggacctccccca
actgtcgtggaatggatgatactgccttgggttctaggtttcatctggggggaaataaag
gaaatgtgggatggtggattcactgaatacatccatgattggtggaatttgatggatttt
gcaatgaactccctctacctggcaactatttccttgaagattgtggcctatgtcaagtat
aatggttctcgtccaagggaagaatgggaaatgtggcacccgactctgattgcggaagca
ctcttcgcgatatcgaacattttaagttccttgcgtctcatatccttgttcacagccaac
tcccacttagggcctctgcagatctccttgggacgcatgctgcttgatatactcaaattt
ctctttatctactgcctagtactactggcttttgccaacggactgaaccagctttatttt
tactatgagaccagagctattgatgaacctaacaactgcaaaggaatccggtgtgaaaaa
cagaacaacgccttctccacgctctttgaaacccttcagtcactcttctggtctgtgttt
ggccttttaaacctctatgttaccaatgtgaaggcccggcatgaattcacggagtttgtg
ggagctactatgtttgggacatacaacgtcatctccctggtagtgctactgaacatgctc
attgccatgatgaacaactcctaccagctcattgccgaccatgctgatattgagtggaag
tttgcgagaacgaagctctggatgagttactttgatgaaggtggcaccttaccacctcct
ttcaacatcatccccagccccaaatcatttctctatcttggcaactggttcaacaacacc
ttctgtcccaagagagaccccgatgggagacgaaggaggcacaacttgagaagcttcaca
gaacgtcatgctgacagcctgatccaaaatcaacattatcaggaagttatcagaaatcta
gtcaagagatatgtggctgccatgataagaaactcgaaaacaaatgaggggctaacagaa
gaaaattttaaggaattaaagcaggacatttccagctttcgatacgaagtacttgacctc
ttgggaaatagaaaacatccaagaagaagcttttccactagcagcgctgaattctctcaa
agggatgataccaatgatggcagtggtggggctcgggccaaatctaagagtgtctctttc
aatttaggctgcaagaaaaaggcctgccagggagcacctctcatcagaaccatgccaaga
gctagtggtgcccaaggaaagccgaaagctgagtcgtcaggcaaacggtccttcatgggt
ccctctttcaagaaactgggtctcctgttctccaagtttaatggtcagacctctgaacct
acttcggagccaatgtacacaatctctgatggcatcgcacagcagcactctatgtggcag
gacatcagatattctcagatggagaaagggaaggcagaggcctgttcgcaaagtgagatg
aacctcagtgaggtagagttaggtgaaatccggggtgctgctcggagcagtgaatgcccc
ctagcctgttccagctctcttcactgtgcatccggcatctgctcctcaaattcgaaactt
ttagactcatcagaggacgtatttgaaacttggggagaggcctgtgacttgctcatgcac
aaatggggtgatggacaggaagaacaagttacaactcggctctaa

DBGET integrated database retrieval system