KEGG   Rattus norvegicus (rat): 140933
Entry
140933            CDS       T01003                                 

Gene name
Trpc5
Definition
(RefSeq) short transient receptor potential channel 5
  KO
K04968  transient receptor potential cation channel subfamily C member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
rno04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    140933 (Trpc5)
  09158 Development and regeneration
   04360 Axon guidance
    140933 (Trpc5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    140933 (Trpc5)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    140933 (Trpc5)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     140933 (Trpc5)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   140933 (Trpc5)
SSDB
Motif
Pfam: Ion_trans TRP_2 Ank_2 Ank_4 Ank_3 Ank PKD_channel
Other DBs
NCBI-GeneID: 140933
NCBI-ProteinID: NP_543174
RGD: 619787
Ensembl: ENSRNOG00000027233
UniProt: Q8VD38
Position
X
AA seq 974 aa
MAQLYYKKVNYSPYRDRIPLQIVRAETELSAEEKAFLSAVEKGDYATVKQALQEAEIYYN
VNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRK
PSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVE
CVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAE
YEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHSEELDPQKYHDLAKLKVAIKYHQKE
FVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFI
KKPFIKFICHTASYLTFLFMLLLASQHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIK
EMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRPREEWEMWHPTLIAEA
LFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYF
YYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFV
GATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPP
FNIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRHNLRSFTERHADSLIQNQHYQEVIRNL
VKRYVAAMIRNSKTNEGLTEENFKELKQDISSFRYEVLDLLGNRKHPRRSFSTSSAEFSQ
RDDTNDGSGGARAKSKSVSFNLGCKKKACQGAPLIRTMPRASGAQGKPKAESSGKRSFMG
PSFKKLGLLFSKFNGQTSEPTSEPMYTISDGIAQQHSMWQDIRYSQMEKGKAEACSQSEM
NLSEVELGEIRGAARSSECPLACSSSLHCASGICSSNSKLLDSSEDVFETWGEACDLLMH
KWGDGQEEQVTTRL
NT seq 2925 nt   +upstreamnt  +downstreamnt
atggcccagctgtactacaagaaggtcaactactcaccatacagagaccgcatccccctc
caaatcgtgagggctgagactgagctgtctgctgaggagaaagctttccttagtgctgtg
gagaagggggactatgccaccgtgaagcaggcactgcaggaggccgagatctactacaat
gtcaacatcaactgcatggatcctttgggcaggagcgccctactcattgccattgagaat
gagaacttagagatcatggagctactgctgaaccacagtgtgtatgtgggcgatgcatta
ctctatgccatccgcaaggaggtggtaggagctgtggaacttctgctcagctacaggaag
ccaagtggagagaagcaggttcccactctgatgatggacacccagttctctgagttcaca
ccagacatcacacccatcatgttggcagcccacaccaacaactatgaaatcatcaaattg
cttgtccaaaagcgtgtcactatcccacggccccaccaaatccgctgcaactgtgtggag
tgtgtgtccagttcagaagtagacagcctacgtcattcaaggtcccgactgaacatatac
aaggcactggcaagcccttcgctcatcgccttatcaagtgaggaccctatcctcacagca
ttccggctgggctgggaactcaaggagctgagcaaggtggaaaatgagttcaaggctgag
tatgaggagctctcccaacagtgtaagctctttgccaaggacctgctggatcaagctcgg
agctcccgagaactggagatcattctcaaccatcgagatgaccacagcgaagaacttgac
ccacagaagtaccatgacctggccaagctgaaggtggcaatcaaatatcaccagaaagag
tttgtcgctcagccaaactgtcaacaattgctggccaccttgtggtacgatggcttccct
ggatggcgaagaaaacactgggtagtcaagcttctaacctgcatgaccattggattcctg
tttcctatgctgtccatagcctatctgatctcacccagaagcaaccttgggcttttcatc
aagaaaccctttatcaagttcatctgccacacagcatcctatctgaccttcctcttcatg
cttctcctggcttctcagcatattgtcagaacagacctccatgttcaaggacctccccca
actgtcgtggaatggatgatactgccttgggttctaggtttcatctggggggaaataaag
gaaatgtgggatggtggattcactgaatacatccatgattggtggaatttgatggatttt
gcaatgaactccctctacctggcaactatttccttgaagattgtggcctatgtcaagtat
aatggttctcgtccaagggaagaatgggaaatgtggcacccgactctgattgcggaagca
ctcttcgcgatatcgaacattttaagttccttgcgtctcatatccttgttcacagccaac
tcccacttagggcctctgcagatctccttgggacgcatgctgcttgatatactcaaattt
ctctttatctactgcctagtactactggcttttgccaacggactgaaccagctttatttt
tactatgagaccagagctattgatgaacctaacaactgcaaaggaatccggtgtgaaaaa
cagaacaacgccttctccacgctctttgaaacccttcagtcactcttctggtctgtgttt
ggccttttaaacctctatgttaccaatgtgaaggcccggcatgaattcacggagtttgtg
ggagctactatgtttgggacatacaacgtcatctccctggtagtgctactgaacatgctc
attgccatgatgaacaactcctaccagctcattgccgaccatgctgatattgagtggaag
tttgcgagaacgaagctctggatgagttactttgatgaaggtggcaccttaccacctcct
ttcaacatcatccccagccccaaatcatttctctatcttggcaactggttcaacaacacc
ttctgtcccaagagagaccccgatgggagacgaaggaggcacaacttgagaagcttcaca
gaacgtcatgctgacagcctgatccaaaatcaacattatcaggaagttatcagaaatcta
gtcaagagatatgtggctgccatgataagaaactcgaaaacaaatgaggggctaacagaa
gaaaattttaaggaattaaagcaggacatttccagctttcgatacgaagtacttgacctc
ttgggaaatagaaaacatccaagaagaagcttttccactagcagcgctgaattctctcaa
agggatgataccaatgatggcagtggtggggctcgggccaaatctaagagtgtctctttc
aatttaggctgcaagaaaaaggcctgccagggagcacctctcatcagaaccatgccaaga
gctagtggtgcccaaggaaagccgaaagctgagtcgtcaggcaaacggtccttcatgggt
ccctctttcaagaaactgggtctcctgttctccaagtttaatggtcagacctctgaacct
acttcggagccaatgtacacaatctctgatggcatcgcacagcagcactctatgtggcag
gacatcagatattctcagatggagaaagggaaggcagaggcctgttcgcaaagtgagatg
aacctcagtgaggtagagttaggtgaaatccggggtgctgctcggagcagtgaatgcccc
ctagcctgttccagctctcttcactgtgcatccggcatctgctcctcaaattcgaaactt
ttagactcatcagaggacgtatttgaaacttggggagaggcctgtgacttgctcatgcac
aaatggggtgatggacaggaagaacaagttacaactcggctctaa

KEGG   Rattus norvegicus (rat): 84494
Entry
84494             CDS       T01003                                 

Gene name
Trpc4
Definition
(RefSeq) short transient receptor potential channel 4 isoform beta
  KO
K04967  transient receptor potential cation channel subfamily C member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
rno04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    84494 (Trpc4)
  09158 Development and regeneration
   04360 Axon guidance
    84494 (Trpc4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    84494 (Trpc4)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   84494 (Trpc4)
SSDB
Motif
Pfam: Ion_trans TRP_2 Ank_2 Ank_4 Ank_3 Ank PKD_channel Ank_5
Other DBs
NCBI-GeneID: 84494
NCBI-ProteinID: NP_001076584
RGD: 621276
Ensembl: ENSRNOG00000011133
UniProt: Q91ZM0
Position
2
AA seq 893 aa
MAQFYYKRNVNAPYRDRIPLRIVRAESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFK
ININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKK
PSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVE
CVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSE
YEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEF
VAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIR
KPFIKFICHTASYLTFLFLLLLASQHIDRSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQ
MWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALNPRESWDMWHPTLVAEAL
FAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFY
YEETKGLSCKGIRCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATM
FGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVI
PSPKSLWYLVKWIWTHLCKKKMRRKPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAA
MIREAKTEEGLTEENVKELKQDISSFRFEVLGLLRGSKLSTIQSANAASSASSADSDEKS
HSEEEITRQQAAGALERNIQLESQGLASRGDRSIPGLNEQCVLVDHRERNTDTLGLQVGK
RVCSSFKSEKVVVEDTVPIIPKEKHAQEEDSSIDYDLSPTDTVAHEDYVTTRL
NT seq 2682 nt   +upstreamnt  +downstreamnt
atggctcagttctattacaaacgaaatgtcaacgccccctaccgagaccgcatcccactg
aggatcgtcagggcagaatctgaactctcaccatcagagaaagcctacttgaatgccgtg
gaaaagggggactatgcaagcgtcaagaaatctctggaggaagccgagatttattttaaa
atcaacattaactgcattgacccccttgggaggactgctcttctcattgccattgaaaat
gagaacctggagctgattgaactgttgttgagtttcaatgtctatgttggcgatgcgcta
cttcacgccatcaggaaagaggtggttggagccgtggagctactgctgaaccacaaaaag
cccagcggagagaagcaggtgcctcccatcctccttgacaaacagttctctgaattcacc
ccagacatcacgcctatcatcttggctgcacatacaaataattatgagataatcaaactc
ttggtccagaagggtgtctcggtgcccagaccccacgaggtccgctgtaactgtgttgag
tgtgtctccagctcagacgtggacagcctcaggcactcacggtccaggctcaacatctac
aaggctttggccagcccctcgctcattgcgctgtcaagtgaagaccctttcctcaccgcc
tttcagttaagctgggagctgcaagaactgagtaaggtggagaatgaattcaagtcggag
tatgaggagctgtctagacagtgcaaacagtttgctaaggacctcctagatcagacacgg
agttccagagagctggaaatcattcttaattaccgtgatgacaatagcctgatcgaagaa
cagagtggaaatgatcttgcgaggctaaaattagccattaagtaccgtcaaaaagagttt
gttgctcagcccaactgccagcagctgctcgcttcccgctggtacgatgagttcccaggc
tggaggagaagacactgggcggtgaagatggtgacatgtttcataataggactactcttc
cccgtcttctccgtgtgctacctgatagctcccaaaagcccacttggactgttcatcaga
aagccatttatcaagtttatctgccacacagcctcctatctgacctttttgtttctgctg
ctgctagcctctcagcacatcgacaggtcagacttgaacaggcaaggtccaccaccaacc
atcgtggagtggatgatattaccgtgggtcctgggttttatatggggagagattaaacag
atgtgggatggcggacttcaggattacatccacgactggtggaatctaatggactttgtg
atgaactccttgtatctggcgacaatctccttgaagattgtcgcatttgtaaagtacagt
gctctgaacccacgggaatcatgggacatgtggcaccccaccctggtggcagaggcttta
ttcgcaattgcaaacatcttcagttccctccgcctgatctctctgttcactgccaattct
cacctggggcctctgcagatatctctgggaagaatgctcctggacatcctaaagttctta
ttcatatactgcctcgtgctgctagcttttgcaaatggcctaaatcaactgtacttctac
tatgaagaaacgaaggggttaagctgcaaaggcatacggtgcgaaaaacagaacaacgcg
ttctccacgttatttgagactctacagtccctgttttggtcaatatttggactcatcaat
ctctatgttaccaatgtcaaagcccagcatgagttcactgaatttgttggggccaccatg
tttggcacatataacgtcatctctctggttgtcctcctgaacatgctgatcgctatgatg
aataattcttaccaactaattgccgaccacgcagatatagagtggaaatttgctcgaaca
aagctttggatgagctactttgaagaagggggtaccctgcctacacctttcaatgtcatc
ccaagccccaagtccctgtggtacctggtcaagtggatatggacgcacttatgtaagaaa
aagatgagaagaaagccagaaagctttgggacaattgggcggcgtgctgctgataacttg
agaaggcatcaccaataccaagaggtgatgaggaatctggtgaagcggtacgtggcagcc
atgatcagagaggcaaaaactgaagaaggcttgacagaggagaatgttaaggaactaaag
caagacatttctagcttccgcttcgaagttctgggattgctccggggaagcaagctctca
acaatacagtcagccaacgcagcgagttcagccagctccgcggactccgatgagaagagc
cacagcgaagaagaaattactcgtcaacaggcggcaggagcacttgagagaaatatccaa
ctggaatcccaaggattagcttcacggggtgaccgcagcattcctggtctcaatgaacag
tgtgtgctagtagaccatagagaaaggaatacggacactttgggtttacaggtaggcaag
agagtgtgctcctccttcaagtcggagaaggtggtggtggaagacaccgtccctattata
ccaaaggagaaacacgcccaggaggaggactcaagcatagattatgatttaagccccacg
gacacagttgcccatgaagattatgtgaccacgagattgtga

KEGG   Rattus norvegicus (rat): 89821
Entry
89821             CDS       T01003                                 

Gene name
Trpc1
Definition
(RefSeq) short transient receptor potential channel 1
  KO
K04964  transient receptor potential cation channel subfamily C member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
rno04724  Glutamatergic synapse
rno04726  Serotonergic synapse
rno04929  GnRH secretion
rno04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    89821 (Trpc1)
  09154 Digestive system
   04972 Pancreatic secretion
    89821 (Trpc1)
  09156 Nervous system
   04724 Glutamatergic synapse
    89821 (Trpc1)
   04726 Serotonergic synapse
    89821 (Trpc1)
  09158 Development and regeneration
   04360 Axon guidance
    89821 (Trpc1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    89821 (Trpc1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   89821 (Trpc1)
SSDB
Motif
Pfam: TRP_2 Ion_trans Ank_2 Ank_4 DUF2157
Other DBs
NCBI-GeneID: 89821
NCBI-ProteinID: NP_446010
RGD: 619783
Ensembl: ENSRNOG00000054902
UniProt: Q9QX01
Position
8
AA seq 759 aa
MMAALYPSTDLSGVSSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDY
YMVKKILEENSSGDLNINCVDVLGRNAVTITIENESLDILQLLLDYGCQKLMERIQNPEY
STTMDVAPVILAAHRNNYEILTMLLKQDVALPKPHAVGCECTLCSAKNKKDSLRHSRFRL
DIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLA
QARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTV
WFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASY
FTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEES
RNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLF
FMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGI
FCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVV
IVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYM
ISSLSKWVCSHTSKGKVRRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTD
QATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPRN
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgatggcggccctgtacccgagcacggacctctctggcgtctcctcctcctccctgcct
tcctccccatcctcctcatcgcccaacgaagtgatggcgctgaaggatgtgcgagaggtg
aaggaggagaacaccttgaatgagaagcttttcttgctggcgtgcgacaagggtgactat
tatatggttaaaaagattttggaggaaaacagttcaggtgacttgaacataaattgcgta
gatgtgcttgggagaaatgctgttaccataactattgaaaacgaaagcttggatatactg
cagctgcttttggactacggttgtcagaaacttatggaacgaattcagaatccggaatac
tcaacaacgatggatgttgcaccagttattttagctgctcatcgtaacaactatgagatc
ctcacaatgcttctgaagcaggacgtggctttgcccaagccccatgctgttggctgtgaa
tgcacgctgtgttctgcgaaaaacaaaaaggacagcctcagacattccaggtttcgtctt
gatatctatagatgtctggccagtccagctctaataatgttaacagaggaggatccaatt
ctgagagcgtttgaacttagtgctgacttaaaggaactcagccttgtggaggtggaattc
aggaatgactatgaagagctagcccgtcagtgcaaaatgtttgctaaagatttgcttgcg
caagctcggaattctcgtgaactggaagttatcctaaaccatacatctagtgatgagcct
cttgacaaacgaggactactagaagaaagaatgaatttaagtcgtctgaaacttgctatc
aaatataaccagaaggagtttgtctcccagtcaaattgccagcagttcctgaacaccgtt
tggttcggacagatgtcaggttaccgccgtaagcccacctgtaagaagataatgactgtt
ttgacagttggcattttctggccagttctgtcactgtgttacttgatagctcccaaatct
caattcggcagaatcattcacacaccgttcatgaagtttattattcatggagcttcatat
ttcacattcttgctgttactcaatctctactcacttgtctacaatgaggacaagaaaaat
acaatggggccagcccttgagagaatagactaccttctcatactgtggattattgggatg
atttggtcagacattaagaggctgtggtatgaagggttggaagacttcttagaagaatct
cgtaaccagctcagctttgttatgaattccctttacttggcaacttttgccctcaaagtg
gtggctcacaacaagtttcatgattttgccgaccggaaggactgggatgcgttccacccc
acactggtagcagaagggcttttcgcctttgcaaacgttctgagttaccttcggctcttc
tttatgtacacaaccagctctattttgggcccactgcagatttcaatgggacagatgtta
caagattttgggaaatttctaggaatgttccttcttgttctgttttccttcacgattgga
ctgacacagctctatgacaaagggtacacttccaaagagcagaaggactgcgtaggcatc
ttctgtgaacagcaaagcaacgacaccttccactcgttcattggcacctgctttgctctg
ttctggtacatcttctccttagcgcatgtggccatctttgtcaccaggtttagctatggg
gaagaactgcagtccttcgttggggctgtgattgtcggaacttacaatgtcgtggttgtg
atcgtgcttacaaagctactggtagcgatgcttcataagagcttccagctgatagcaaat
catgaggataaagaatggaagtttgctcgagcgaagctatggctcagctactttgatgac
aaatgcacactgcccccacctttcaacatcattccttctccaaagactatctgctatatg
atcagcagcctcagcaagtgggtgtgctcgcacacctccaaaggcaaggtcagacggcag
aacagcttgaaggagtggagaaacttaaaacaaaagagagatgagaactaccagaaggtg
atgtgctgcctagtgcatcgatacctgacctccatgcgacagaagatgcagagcacagac
caggccaccgtggagaatctcaatgaactgcgccaagatctgtcaaaattcagaaatgaa
ataagggatttgcttggctttcggacttctaaatatgctatgttttatccaagaaattag

DBGET integrated database retrieval system