KEGG   Rattus norvegicus (rat): 140936
Entry
140936            CDS       T01003                                 

Gene name
Rcvrn
Definition
(RefSeq) recoverin
  KO
K13764  recoverin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    140936 (Rcvrn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    140936 (Rcvrn)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   140936 (Rcvrn)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 EF-hand_10
Other DBs
NCBI-GeneID: 140936
NCBI-ProteinID: NP_543177
RGD: 620258
Ensembl: ENSRNOG00000003633
UniProt: Q8VH47
Position
10
AA seq 202 aa
MGNSKSGALSKEILEELQLNTKFTEEELSAWYQSFLKECPSGRITRQEFESIYSKFFPDS
DPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTTAGKPTQKLEWAFSLYDVDGNGTISKN
EVLEIVMAIFKMIKPEDVKNLPDDENTPEKRAEKIWAFFGKKDDDKLTEEEFIEGTLANK
EILRLIQFEPQKVKERIKEKKQ
NT seq 609 nt   +upstreamnt  +downstreamnt
atggggaacagcaagagcggggccctgtccaaggagatcctggaggagttgcaactgaac
actaagttcacagaggaggagctgagcgcctggtaccagtccttcctgaaggagtgtcct
agtggccgcatcacgcggcaggagttcgaaagtatctattccaagttctttccagactcc
gaccctaaggcctacgcccagcacgtgttccgcagcttcgatgccaacagcgatggtacg
ctggacttcaaggagtatgtgatcgctctgcacatgaccacggcgggcaagcccacgcag
aagctcgagtgggccttctcgctctacgacgtagacggcaatgggaccatcagcaagaat
gaagtgttggagatcgtcatggctattttcaaaatgatcaagcctgaggatgtgaagaac
ctcccagatgatgaaaacaccccagagaagcgggctgagaagatctgggcgttctttgga
aaaaaagatgatgataaacttacagaggaggaattcatcgaggggaccctggccaataag
gaaattctgcgactgatccagtttgaacctcaaaaagtgaaggagaggataaaggaaaag
aaacagtga

DBGET integrated database retrieval system