KEGG   Rattus norvegicus (rat): 140937Help
Entry
140937            CDS       T01003                                 

Gene name
Higd1a, Hig1
Definition
(RefSeq) HIG1 hypoxia inducible domain family, member 1A
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: HIG_1_N
Motif
Other DBs
NCBI-GeneID: 140937
NCBI-ProteinID: NP_543178
RGD: 620215
Ensembl: ENSRNOG00000019428
UniProt: Q8VH49
Position
8q32
AA seq 93 aa AA seqDB search
MSTNTDLSLSSYDEGQGSKFIRKARETPFVPIGMAGFAAIVAYGLYKLKSRGNTKMSIHL
IHMRVAAQGFVVGAMTLGMGYSMYQEFWAKRKP
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccaacacagacctttctctctcttcatacgatgaaggtcaggggtccaagttt
attcggaaagctagggagacaccgtttgtccccattggaatggccggcttcgcagcgatt
gttgcatatgggctctacaagctgaagagcaggggaaacacgaagatgtctattcacttg
atccacatgcgtgtggcagcccagggctttgttgtgggggccatgactcttggtatgggc
tattccatgtatcaagaattctgggccaagcgtaagccttag

DBGET integrated database retrieval system