KEGG   Rattus norvegicus (rat): 140940Help
Entry
140940            CDS       T01003                                 

Gene name
Arf3, Ac1-253
Definition
(RefSeq) ADP-ribosylation factor 3
  KO
K07938  ADP-ribosylation factor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    140940 (Arf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    140940 (Arf3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    140940 (Arf3)
   04031 GTP-binding proteins [BR:rno04031]
    140940 (Arf3)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    140940 (Arf3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   140940 (Arf3)
  Exosomal proteins of colorectal cancer cells
   140940 (Arf3)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    140940 (Arf3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K
Motif
Other DBs
NCBI-GeneID: 140940
NCBI-ProteinID: NP_543180
RGD: 621273
Ensembl: ENSRNOG00000054775
UniProt: P61206
Position
7q36
AA seq 181 aa AA seqDB search
MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNK
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatatctttgggaaccttctgaagagcctgatcgggaagaaggagatgcgcatc
ctgatggtgggcctggatgctgcaggaaagaccaccatcctctataagctgaagcttggc
gagattgttaccaccattcccaccatcgggtttaatgtggagacagtggaatataagaat
atcagcttcacagtatgggacgtaggtggccaggacaagattcggcccctctggagacac
tacttccagaatacccaaggcttgatatttgtggttgacagcaatgaccgggagcgagtg
aacgaggcccgggaagagctgatgaggatgctggcggaggatgagctccgggatgctgtg
ctgcttgtgtttgcaaacaaacaggatttgccgaatgctatgaatgctgctgagatcaca
gacaagctgggcctgcactctctgcgccaccgcaattggtacattcaggccacctgtgcc
accagcggggacgggctctatgaaggcttggactggctggccaatcagctcaaaaacaag
aagtga

DBGET integrated database retrieval system