KEGG   Rattus norvegicus (rat): 140943
Entry
140943            CDS       T01003                                 

Gene name
Ppp4r1, Pp4r1
Definition
(RefSeq) protein phosphatase 4, regulatory subunit 1
  KO
K15424  serine/threonine-protein phosphatase 4 regulatory subunit 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    140943 (Ppp4r1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    140943 (Ppp4r1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-4
    Regulatory subunits
     140943 (Ppp4r1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Protein phosphatase 4
     140943 (Ppp4r1)
SSDB
Motif
Pfam: HEAT HEAT_2 WRNPLPNID Cnd1 Vac14_Fab1_bd
Other DBs
NCBI-GeneID: 140943
NCBI-ProteinID: NP_543183
RGD: 619798
Ensembl: ENSRNOG00000013733
UniProt: Q8VI02
Position
9q37
AA seq 951 aa
MADLSLLQEDLPEDADGLGVDDYSSESDVIIIPSALDFVSQDEMLTPLGRLDKYAASENV
FNRQMVARSLLDTLREVCGEERDCIAVLERISRLADDSEPTVRAELMEQVPHIALFCQEN
RPSIPYAFSKYLLPIVVRYLADQNNQVRKTSQAALLALLEQELIERLDVETKVCPVLIDL
TAPDSNDDVKTEAVAIMCKMAPMVGKDITERLILPRFCEMCCDCRMFHVRKVCAANFGDI
CSVVGQQATEEMLLPRFFQLCSDNVWGVRKACAECFMAVSCATCQEIRRTKLSALFINLI
SDPSRWVRQAAFQSLGPFISTFANPSSSGQCFKDESKSSEDKDRIRDDGVVQEEQSRPED
APSDLSAPHSSARLDGTLEGCAAETPGDSAGDMRVPADSSLLCTLSSESPQEAASDAESG
KKHDNNSKSASRPDVGTSSPEPTPLDQEMFNSFHFWRTPLPQIDLDKELQQDPGERPSPE
RTGDAPAAPVPGSPSITMATRKELEEMIENLEPHMDDPDVKAQVEVLSAALRASTLDAHD
EAGGAEQRSELQDDAVGAGGELPNCSISEDTSEPLVIAAEENMEATPDYIHGGADVGPGG
GGGFSPDEERRPKVQDVVPQALLDQYLSMTDPSRAQTVDTEIAKHCAYSLPGVALTLGRQ
NWHCLRETYETLASDMQWKVRRTLAFSIHELAVILGDQLTAADLVPIFNGFLKDLDEVRI
GVLKHLHDFLKLLHIDKRREYLYQLQEFLVTDNSRNWRFRAELAEQLILLLELYSPRDVY
DYLRPIALNLCADKVSSVRWISYKLVSEMVKKLHMATPPTFGVELINELVENFGRCPKWS
GRQAFVFVCQTVIEDDCLPMDQFAVHLMPHLLTLANDRVPNVRVLLAKTLRQTLLEKEYF
LASASCHQEAVEQTIMALQMDRDSDVKYFASIHPSSTKLSEDAMSTASSTY
NT seq 2856 nt   +upstreamnt  +downstreamnt
atggcggacctctcgctgctccaggaggacctgccggaggacgcggacggacttggtgtg
gatgactacagctcagagtctgatgtgattattataccttcagccctggacttcgtctca
caagatgaaatgttgacacccttggggaggctggacaagtatgctgcaagtgagaacgtc
tttaacagacaaatggtggcccggagtttgctggatactctgagggaagtctgtggtgag
gagagagactgcattgctgtcttggaaaggatcagccgattggctgatgactcagaacca
accgtgagagccgagctgatggaacaggtgccgcacatcgcactgttttgtcaagagaac
cgaccttccataccatatgccttttccaagtacttactgccaatcgtggttagatacctt
gcagaccagaataaccaggtgaggaaaaccagccaggcagctttgctggctctgctggag
caggagctgattgagcgactcgatgtggagaccaaggtgtgccccgtcctcatagacttg
actgccccagacagcaatgacgatgtgaagacagaggccgtggctataatgtgcaagatg
gcccccatggttgggaaagatattacagagcgtctcatcctccctaggttttgtgagatg
tgctgtgactgtagaatgtttcacgtccgaaaggtctgtgctgccaattttggagacatt
tgcagcgtagttggccagcaagctacagaagaaatgctgctgcccaggttcttccagctg
tgttctgacaatgtgtggggcgtccggaaggcctgtgctgagtgcttcatggccgtctcc
tgcgcgacatgccaagaaatccgacggacaaagttgtcagcactgtttattaacttgatc
agtgatccttcacgttgggttcgccaagcagcctttcagtccctggggcctttcatatcc
acatttgctaatccatcaagctcgggccagtgcttcaaagatgagagcaaaagctcagaa
gacaaagacaggatcagagacgatggtgttgtacaagaagagcagagcaggccagaggac
gcaccttcagacctcagtgcccctcactccagtgccaggctggacggcacacttgaaggc
tgtgctgccgagacgcctggggactctgcaggtgacatgcgtgttccagcggacagctcc
ttactctgtactttgtcctcagagtctcctcaggaagcagctagtgacgctgagagtggt
aaaaagcacgataacaacagcaagtctgcgtcccggccagacgttggcaccagctcccca
gagcccactcccttagatcaggaaatgttcaactccttccatttctggaggactcctcta
ccccagatagatcttgataaagagctccaacaggaccctggggagaggcccagcccagag
agaacaggagatgcacctgcagcccctgtaccaggttctcccagtatcaccatggctacc
cggaaggaactagaagaaatgatagaaaacctagagccgcacatggatgacccggatgtt
aaagcccaggtggaagtgctgtcggccgccctgcgcgcttctaccctggatgctcacgac
gaggctggcggtgcagagcagcggagtgagctgcaggacgacgcagtgggtgccggcggc
gagcttccaaactgtagcatcagcgaagacacttctgagcctctggtcatcgctgctgag
gagaatatggaggccactcctgactatatccatggaggtgcggatgtaggccccggtggc
ggtggtggcttcagcccggatgaagagaggagacccaaagtccaggatgtcgtaccacaa
gcgttactagaccagtacctgtcaatgaccgacccttctcgagcacagacagtcgacacc
gagatcgctaagcactgtgcatacagtctgccgggtgtggctctgacccttggcagacag
aactggcactgcttgagagagacttacgagaccctagcgtcagacatgcagtggaaagtt
cgaagaactctggccttctccatccatgagctcgcggtgattctcggggaccagctgaca
gcagcagacctggttccgatttttaatgggtttttaaaagatcttgacgaagtcaggata
ggtgttctcaaacacttgcatgactttctgaagcttcttcatattgataaaagaagagag
tacctttatcaactccaggagtttttggtgacagacaacagtagaaattggcggtttcga
gctgaactggcagaacagctgattttacttctagaattatatagtcccagagatgtttat
gattacttacgtcccattgctctgaatctgtgtgcagacaaagtttcttcagtccgttgg
atttcctacaagttggtcagtgagatggtgaagaagctacacatggcgacgccgccaacg
ttcggagtcgagctcatcaatgagctggtggagaacttcggcaggtgtccaaagtggtcg
ggccggcaggccttcgtcttcgtgtgccagactgtcattgaggacgactgcctccccatg
gaccagtttgctgtgcacctgatgccacatttgctgaccttggcaaatgacagggttccc
aacgttagagtgctgcttgcaaaaacccttcgacagactctactagagaaagaatacttc
ttagcctctgccagctgtcatcaggaggccgtggagcagacaatcatggcccttcagatg
gatcgagacagtgacgtcaagtactttgcaagcatccacccgtccagtaccaaactctct
gaagacgcaatgagtacagcttcctccacctactga

DBGET integrated database retrieval system