KEGG   Rattus norvegicus (rat): 140946Help
Entry
140946            CDS       T01003                                 

Gene name
Paics, Ade2h1, Airc
Definition
(RefSeq) phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase
  KO
K01587  phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
Module
rno_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    140946 (Paics)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     140946 (Paics)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     140946 (Paics)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAICAR_synt AIRC
Motif
Other DBs
NCBI-GeneID: 140946
NCBI-ProteinID: NP_543186
RGD: 620066
Ensembl: ENSRNOG00000002101
UniProt: P51583
Position
14p11
AA seq 425 aa AA seqDB search
MATAEVLNIGRKLYEGKTKEVYELLDSPGRVLLQSKDQITAGNAARKNHLEGKAAISNKI
TSCIFQLLQEAGIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYR
FYPPKVEMFFKDDANNDPQWSEEQLIAAKFCFAGLVIGQTEVDIMSHATQAIFEILEKSW
LPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPE
GLQMVKKNFEWVADRVELLLKSNSQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVT
SAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPITADWGAQ
DVWSSLRLPSGIGCSTILSPEGSAQFAAQIFGLNNHLVWAKLRASKLNTWISLKQADKKI
RECNL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagctgaagtactgaacatcgggagaaagctgtatgagggtaaaacaaaggaa
gtctatgaattgttagacagtccaggaagagtcctcctgcagtccaaggaccagattaca
gcaggaaatgcagctagaaagaaccacctggaaggcaaagccgccatctccaataagatc
accagctgcatatttcagttgttacaggaagctggtataaaaactgctttcaccaagaaa
tgtggggagactgctttcattgcaccccagtgtgaaatgattccaattgagtgggtatgc
cgaagaatcgccactggatcttttctcaaaaggaaccctggtgtgaaggaggggtatagg
ttttatccaccaaaagtagagatgttcttcaaggatgatgccaataacgacccacaatgg
tctgaggagcaactcatcgctgcaaaattttgttttgctggactcgttatagggcaaact
gaagtggatatcatgagtcatgccacacaagctatttttgaaattctggagaaatcctgg
ctgccccaaaactgtacgctggttgatatgaagattgagtttggcgttgatgtaaccacc
aaagagattgttcttgctgatgtcatagataatgattcctggagactatggccatcagga
gatcggagccagcagaaagacaaacagtcttatcgggatctcaaagaagtaactccggaa
ggactccagatggtaaagaagaactttgagtgggttgcagaccgagtggagttgcttctc
aagtcaaacagtcagtgcagggtggtagtgctgatggggtcgacctctgaccttggtcac
tgtgaaaaaattaagaaggcttgtggaaactttgggattccatgtgaacttagagtaaca
tctgcacataaaggaccagatgaaactttgaggattaaagcagaatatgaaggggatggc
atacctactgtatttgtcgcagtggcgggcaggagcaatggactgggcccagtgatgtct
ggtaatactgcatacccggttatcagctgtcccccaatcacagcagactggggtgctcag
gatgtgtggtcatctctgcgactgcccagtggtattggctgttcaactatactttctcca
gaaggatcagcccagtttgctgctcagatatttgggttaaacaaccatttggtgtgggcc
aaacttcgagcgagcaaactgaacacgtggatatccttaaagcaggctgataagaaaatc
agagagtgcaatttgtaa

DBGET integrated database retrieval system