KEGG   Rattus norvegicus (rat): 154985Help
Entry
154985            CDS       T01003                                 

Gene name
Cyp26a1, Cyp26
Definition
(RefSeq) cytochrome P450, family 26, subfamily a, polypeptide 1
  KO
K07437  cytochrome P450 family 26 subfamily A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00830  Retinol metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    154985 (Cyp26a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    154985 (Cyp26a1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP26 family
   154985 (Cyp26a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 154985
NCBI-ProteinID: NP_569092
RGD: 620161
Ensembl: ENSRNOG00000016750
UniProt: Q8VIL0
Position
1q53
AA seq 497 aa AA seqDB search
MGLPALLASALCTFVLPLLLFLAALKLWDLYCVSSRDRSCALPLPPGTMGFPFFGETLQM
VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTIL
GAGCLSNLHDSSHKQRKKVIMQAFNREALQCYVPVIAEEVSGCLEQWLSCGERGLLVYPE
VKRLMFRIAMRILLGCEPGPAGGGEDEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGVKAR
NLIHARIEENIRAKIRRLQAAEPDAGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG
GHETTASAATSLITYLGLYPHVLQKVREEIKSKGLLCKSHHEDKLDMETLEQLKYIGCVI
KETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVADSFTNKEEFNPDRFT
SLHPEDTSRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARRCDWQLLNGPPTMKTSPPV
YPVDNLPARFTHFQGDI
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggggctcccggcgctgctggccagtgctctctgcaccttcgtgctgccgctgctgctc
ttcctggcggcgctcaagctctgggacctgtactgtgtgagcagccgcgatcgcagctgc
gctctccccttgcccccgggtaccatgggcttcccattctttggggaaacattgcagatg
gtgctgcagcggaggaagtttctgcagatgaagcgcaggaaatacggcttcatctacaag
acgcatctgtttgggcggcccacggtgcgagtgatgggcgcggataatgtgcggcgcatc
ttgctgggggagcaccggttggtgtcagtgcactggcctgcttcggtgcgcaccatcctg
ggcgccggctgcctctccaacctgcatgattcctcgcacaagcagcgaaagaaggtgatt
atgcaggccttcaaccgagaggcgctccagtgctacgtgccagtgattgctgaagaagtg
agcggttgtctggagcagtggctaagctgcggcgagcgcggcctcctggtctaccccgag
gtgaagcgcctcatgttccgcatcgccatgcgcatcctgctgggctgcgagccgggtcca
gcgggcggcggggaagacgagcagcagctagtggaggctttcgaggagatgacccgcaat
ctcttctctctccccattgacgtgccctttagcgggctgtaccggggcgtgaaggcgcgg
aaccttatccacgcgcgcatcgaggagaacattcgggccaagatccgccggcttcaggcc
gcagagccggatgcgggctgcaaggacgcactgcagctcttgattgagcactcatgggag
agaggagagaggctggatatgcaggcactaaaacaatcgtccacagagctcctctttggt
ggccatgaaactacagccagtgcagccacatcactgatcacctacctaggactctaccca
catgtcctccaaaaagttcgagaagagataaagagcaagggcttactttgcaagagccat
cacgaggacaagttagacatggaaactttggaacagctcaaatacattgggtgtgttatt
aaggagacccttcgattgaatcctccggttccgggagggtttcgggtggctctgaagact
tttgagctgaacggttaccagattcccaaggggtggaatgttatttacagtatctgtgac
acccatgacgtggcagacagcttcactaacaaggaggagtttaatcccgaccgatttaca
tcgcttcatccagaggacacctccaggttcagtttcattccatttggaggaggccttcgg
agctgcgtaggcaaagagtttgcaaaaattcttcttaagatatttaccgtggagctggcc
agacgttgtgactggcagctgctaaatggacctcctacaatgaagacaagcccccccgtt
taccctgtggacaatcttcctgcaagattcacccacttccagggagatatctga

DBGET integrated database retrieval system