KEGG   Rattus norvegicus (rat): 155012
Entry
155012            CDS       T01003                                 

Gene name
Cfh
Definition
(RefSeq) complement factor H precursor
  KO
K04004  complement factor H
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    155012 (Cfh)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    155012 (Cfh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    155012 (Cfh)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   155012 (Cfh)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 155012
NCBI-ProteinID: NP_569093
RGD: 620428
Ensembl: ENSRNOG00000030715
UniProt: Q5XJW6 G3V9R2 Q91YB6
Position
13
AA seq 1235 aa
MRLSARIIWLILWTVCVAEDCKGPPPRENSEILSGSWSEQLYSEGTQATYKCRPGYRTLG
TIVKVCKNGEWVPSNPSRICRKRPCGHPGDTPFGSFRLAVGSEFEFGAKVVYTCDEGYQL
LGEIDYRECDADGWTNDIPICEVVKCLPVTELENGRIVSGAAEPDQEYYFGQVVRFECNS
GFKIEGQKEMHCSENGLWSNEKPQCVEISCLPPRVENGDGIYLKPVYKENERFQYKCKQG
FVYKERGDAVCTGSGWNPQPSCEEMTCLTPYIPNGIYTPHRIKHRIDDEIRYECKNGFYP
ATRSPVSKCTITGWIPAPRCSLKPCDFPQFKHGRLYYEESRRPYFPVPIGKEYSYYCDNG
FTTPSQSYWDYLRCTVNGWEPEVPCLRQCIFHYVEYGESLYWQRRYIEGQSAKVQCHSGY
SLPNGQDTILCTENGWSPPPKCVRIKTCSVSDIEIENGFFSESDYTYALNRKTRYRCKQG
YVTNTGEISGIITCLQDGWSPRPSCIKSCDMPVFENAMTKNNNTWFKLNDKLDYECHIGY
ENEYKHTKGSITCTYDGWSSTPSCYERECSIPLLHQDLVVFPREVKYKVGDSLSFSCRSG
HRVGADLVQCYHFGWSPNFPTCEGQVKSCDQPLEIPNGEIKGTKKVEYSHGDVVEYDCKP
RFLLKGPNKIQCVDGKWTTLPICVEYERTCGDLPALEHGSVQLSVPPYHHGDSVEFTCAE
TFTMIGHAVVFCISGRWTELPQCVATDQLEKCKAPKSTGIDAIHPNKNEFNHNFSVSYRC
RQKQEYEHSICINGRWDPEPNCTRNEKRFCPPPPQIPNAQVIETTVKYLDGEKVSVLCQD
GYLTQGPEEMVCKHGRWQSLPRCTEKIPCSQPPKIEHGSIKSPRSSEERDLIESSSYEHG
TTFSYVCDDGFRISEENRVTCNMGKWSSLPRCVGIPCGPPPSIPLGIVSHELESYQYGEE
VTYNCSEGFGIDGPAFIKCVGGQWSEPPKCIKTDCDNLPTFEIAKPTEKKKKSYRSGEQV
TFRCPPPYRMDGSDIVTCVNTKWIGQPVCKDNSCVNPPHVPNATILTRHKTKYPSGDKVR
YDCNKPFELFGEVEVMCQNGIWTEPPKCKDSTGKCGPPPPIDNGDITSLSLPVYAPLSSV
EYQCQNYYLLKGNKIVTCRNGKWSQPPTCLHACVIPEDIMEKHNIVLRWRENAKIYSQSG
ENIEFMCKPGYRKFRGSPPFRTKCIEGHINYPTCV
NT seq 3708 nt   +upstreamnt  +downstreamnt
atgagactgtcagcaagaattatttggcttatattatggactgtttgtgtagcagaagat
tgtaaaggtcctcctccaagagaaaattcagaaattctctcaggttcgtggtctgaacaa
ctatattcagaaggcactcaggcaacctacaaatgccgccctggataccgaacacttggt
actattgtaaaagtatgcaagaatggagaatgggtaccttctaacccatcaaggatatgt
cggaaaaggccatgtgggcatcccggagacacaccctttgggtcctttaggctggcagtt
ggatctgaatttgaatttggtgcaaaggttgtttatacatgtgatgaagggtaccaactc
ttaggtgaaattgattaccgtgaatgtgatgcagatgggtggaccaatgatattccaata
tgtgaagttgtgaagtgcttgccagtgacagaactggagaatggaagaattgtgagtggt
gcagccgaaccagaccaggaatattattttggacaggtggtacgctttgaatgcaactcc
ggcttcaagattgaaggacagaaagaaatgcactgctcagaaaatggcctctggagcaat
gaaaagccacagtgtgtggaaatttcttgcctgccaccacgagttgaaaatggagatggt
atatatctgaaaccagtttacaaggagaatgaaagattccaatataaatgtaagcaaggt
tttgtgtacaaagaaagaggggatgctgtctgcacgggttctggatggaatcctcagcct
tcctgtgaagaaatgacatgtttgactccatatattccaaatggtatctacacacctcac
aggattaaacacagaattgatgatgaaatcagatatgaatgtaaaaatggcttctatcct
gcaacccgatcacctgtttcaaagtgtacaattactggctggatccctgctccaagatgt
agcttgaaaccttgtgattttccacaattcaaacatggacgtctgtattatgaagaaagc
cggagaccctacttcccagtacctataggaaaggagtacagctattactgtgacaacggg
tttacaacgccttcacagtcatactgggactaccttcgttgcacagtaaatgggtgggag
cctgaagttccatgcctcaggcaatgtattttccattatgtggaatatggagaatcttta
tactggcaaagaagatatatagagggtcagtctgcaaaagtccagtgtcacagtggctat
agtcttccaaatggtcaagatacaatattatgtacagaaaatggctggtcccctcctccc
aaatgcgtccgtatcaagacttgttcagtatcagatatagaaattgaaaatgggtttttt
tctgaatctgattatacatatgctctaaatagaaaaacacggtatagatgtaaacaggga
tatgtaacaaataccggagaaatatcaggaataattacttgtcttcaagatggatggtca
cctcgaccctcatgcattaagtcttgtgatatgcctgtatttgagaatgctatgactaag
aataataacacatggtttaaactcaatgacaaattagactatgaatgtcacattggatat
gaaaatgaatataaacataccaaaggctctataacatgtacttatgatggatggtctagt
acaccctcctgttatgaaagagaatgcagcattcccctgttacaccaagacttagttgtt
tttcccagagaagtaaaatacaaagttggagattcgttgagtttctcttgccgttcagga
cacagagttggagcagatttagtgcaatgctaccactttggatggtcccctaatttccca
acgtgtgaaggccaagtaaaatcatgtgaccaacctcttgaaatcccgaatggggaaata
aagggaacaaaaaaagttgaatacagccatggtgacgtggtggaatatgattgcaaacct
agatttctactgaagggacccaataaaatccagtgtgttgacgggaagtggacaaccttg
ccgatatgcgttgagtatgagagaacatgtggagaccttcctgcacttgagcatggctct
gtccagttatctgtccctccctaccaccacggagattcagtggagttcacttgtgcagaa
accttcacaatgattgggcatgcagtagttttctgcattagtggaaggtggaccgagctt
cctcaatgtgttgcaacagatcaactggagaagtgtaaagccccgaagtcaactggcata
gatgcaattcatccaaataagaatgaatttaatcataactttagtgtgagttacagatgt
agacaaaagcaggagtatgaacattcaatctgcatcaatggaagatgggatcctgaacca
aactgtacaagaaatgagaaaagattctgccctcctcccccacagattccaaatgcccaa
gtgattgaaaccacagtgaaatacttggatggagagaaagtatctgttctttgccaagat
ggttacctaactcagggcccagaagaaatggtgtgtaaacatggaaggtggcagtcgtta
ccacgctgcacggaaaaaattccatgttcccagccccctaaaattgaacatggatctatt
aagtcgcccaggtcctcagaagagagagatttaattgagtccagcagttatgaacacgga
actacattcagctatgtctgtgatgatggattcaggatatctgaagaaaatagggtaacc
tgcaacatgggaaaatggagctctctgcctcgttgtgttggaataccttgtggaccccca
ccttcaattcctcttggtattgtttctcatgaactagaaagttaccaatatggagaggag
gttacatacaattgttctgaaggctttggaattgatggaccagcatttattaaatgtgta
ggaggacagtggtctgaaccacccaaatgcataaaaactgattgtgacaacttgcccaca
tttgaaattgccaaaccgacagaaaagaaaaaaaaatcatacaggtcaggagaacaagtg
acattcagatgtccacctccgtatcgaatggatggctctgacattgtcacatgtgttaat
acgaagtggattggacagccggtatgcaaagataattcctgtgtgaatccaccacatgtg
ccaaatgctactatactaacaaggcacaagactaaatatccatctggtgacaaagtacgt
tatgactgtaataaaccttttgaattatttggggaagtggaagtgatgtgccaaaacggg
atttggacagaaccaccgaaatgcaaagattcaacagggaaatgtgggcctcctccacct
attgacaatggagacatcacctccttgtcattaccagtatatgcaccattatcatcagtt
gaatatcaatgccagaactattatctacttaagggaaataagatagtaacatgtagaaat
ggaaagtggtctcagccaccaacctgcttacatgcatgtgtgataccagaagatattatg
gaaaaacataatatagttctcagatggagggaaaatgcaaagatttattcccaatcaggg
gagaatattgaattcatgtgtaaacctggatatagaaaattcagaggatcacctccgttt
cgtacaaagtgcattgagggtcacatcaattatcccacttgtgtataa

DBGET integrated database retrieval system