KEGG   Rattus norvegicus (rat): 155140
Entry
155140            CDS       T01003                                 

Gene name
Il23a
Definition
(RefSeq) interleukin-23 subunit alpha precursor
  KO
K05426  interleukin 23 subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04659  Th17 cell differentiation
rno05133  Pertussis
rno05152  Tuberculosis
rno05200  Pathways in cancer
rno05321  Inflammatory bowel disease
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    155140 (Il23a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    155140 (Il23a)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    155140 (Il23a)
   04659 Th17 cell differentiation
    155140 (Il23a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    155140 (Il23a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    155140 (Il23a)
   05152 Tuberculosis
    155140 (Il23a)
  09163 Immune disease
   05323 Rheumatoid arthritis
    155140 (Il23a)
   05321 Inflammatory bowel disease
    155140 (Il23a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    155140 (Il23a)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   155140 (Il23a)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 155140
NCBI-ProteinID: NP_569094
RGD: 620873
Ensembl: ENSRNOG00000003254
UniProt: Q91Z84
Position
7
AA seq 196 aa
MLDCRAIILLWLLPWATQGLAVPRSSSPDWAQCQQLSRNLCTLAWSAHTPVGQMDLLREE
GEEETKSDVPRIQCGDGCDPQGLKDNSQFCLQRIRQGLVFYKHLLDSDIFTGEPSLLPDS
PVDQLHTSLLGLSQLLQPEDHHWETQQMPRLSPSQQWQRSLLRSKILRSLQAFLAIAARV
FAHGAATLTEPLVPTA
NT seq 591 nt   +upstreamnt  +downstreamnt
atgctggattgcagagcaataatactcctgtggctgttgccctgggccactcaggggctg
gctgtgcctaggagtagcagtcctgactgggctcagtgccagcagctctcccggaatctc
tgcacactagcctggagtgcacacacaccagtgggacaaatggatctactaagagaagaa
ggggaagaagagactaaaagtgacgtgccccgtatccagtgtggtgatggttgtgatccc
caaggtctcaaggacaacagccagttctgtttgcaaaggatccgccaaggtctggtgttt
tataagcacctgctggactcggacatcttcacaggggagccttctctactcccggatagc
cctgtggaccagcttcatacctccctactgggcctcagccagctcctccagccagaggat
caccactgggagactcaacagatgcctcgcctgagtcccagccagcagtggcagcgttct
cttctccgttccaagatccttcgcagcctccaagcctttctggccatagctgcccgggtc
tttgcccacggagcagcaactctgactgagcccttagtgccaacggcttaa

DBGET integrated database retrieval system