KEGG   Rattus norvegicus (rat): 155183Help
Entry
155183            CDS       T01003                                 

Gene name
Skap2, Scap2, Scap55r
Definition
(RefSeq) src kinase associated phosphoprotein 2
  KO
K23471  src kinase-associated phosphoprotein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    155183 (Skap2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH SH3_1 SH3_9 SH3_2 PH_11 PH_3 PH_9 PH_8
Motif
Other DBs
NCBI-GeneID: 155183
NCBI-ProteinID: NP_569097
RGD: 620159
Ensembl: ENSRNOG00000012228
UniProt: Q920G0
Position
4q24
AA seq 358 aa AA seqDB search
MPNPGSTSSPGSIPEEIRNLLADVETFVADTLKGENLSKKAKEKRDSLIKKIKDVKSVYP
QEFQDKGDAEEGDEYDDPFAGPPDTISLASERYDKDDDGPSDGNQFPPIAAQDLSFVIKA
GYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIEGYDVRMNNTLRKD
AKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQDMGSDVIPEDEDEKGDLYDDV
DHPVPVSSPQRSQPIDDEIYEELPEEEEDTASVKMDEQGKGSRDSVQHPSGDKSTDYANF
YQGLWDCTGSLSDELSFKRGDVIYILSKEYNRYGWWVGEMQGAIGLVPKAYLMEMYDI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaccccggcagtacctcctctcccggctcaatccctgaggaaattaggaacctg
ttggcagatgttgaaacatttgtggcagacacactgaaaggggaaaatttatccaagaaa
gccaaggaaaagagagactctctcattaagaagataaaagatgtaaagtctgtctatcct
caggaatttcaagacaaaggtgatgccgaggagggggatgaatatgatgatccttttgct
gggcctccagacacgatttccttagcctcagaacgctatgacaaagatgacgatggcccc
tctgatggaaaccagtttcctcccattgcagcccaggacctttcttttgtcataaaggct
ggttacctggaaaaacgcagaaaagatcacagctttctggggtttgaatggcagaaacgg
tggtgtgctctcagcaaaacagtgttctattattacgggagtgataaagacaaacaacag
aaaggggaatttgccatagagggctatgacgtcagaatgaacaacacccttaggaaggat
gcaaagaaagattgctgtttcgaaatctgtgctcccgataaacgtatctatcagtttaca
gcagcctctcccaaagatgctgaggaatgggtccagcagctgaaattcatattacaagac
atgggatctgacgttattcccgaggatgaagatgaaaaaggggacttatatgatgatgtt
gatcatcctgttccggtcagcagcccacaaaggagccaaccaatagatgatgaaatttat
gaggaacttccagaggaggaagaggacaccgcttcagtgaagatggacgaacaagggaag
gggagtcgggacagtgtacagcatccctcaggagataaaagcaccgattatgctaatttt
taccagggcttgtgggactgcactggatctctttctgatgagttgtcctttaagcgtggt
gatgtgatttacattcttagcaaggaatacaatagatatggctggtgggtaggagaaatg
cagggagccattggcttggtgcctaaagcctacctaatggagatgtatgatatttga

DBGET integrated database retrieval system