KEGG   Rattus norvegicus (rat): 155423
Entry
155423            CDS       T01003                                 

Gene name
Anxa7
Definition
(RefSeq) annexin A7
  KO
K17095  annexin A7/11
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    155423 (Anxa7)
   04147 Exosome [BR:rno04147]
    155423 (Anxa7)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   155423 (Anxa7)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   155423 (Anxa7)
  Exosomal proteins of other body fluids (saliva and urine)
   155423 (Anxa7)
  Exosomal proteins of colorectal cancer cells
   155423 (Anxa7)
  Exosomal proteins of bladder cancer cells
   155423 (Anxa7)
SSDB
Motif
Pfam: Annexin
Other DBs
NCBI-GeneID: 155423
NCBI-ProteinID: NP_569100
RGD: 621173
Ensembl: ENSRNOG00000007136
UniProt: Q6IRJ7
Position
15p16
AA seq 463 aa
MSYPGYPPTGYPPFPGYPPAGQESSFPTSGQYPYPSGFPPMGGGAYPPAPSGGYPGAGGY
PSPGGYPAPGGYPGTLNPGGPPSYPGGQGFGAPPGGAGFSGYPQPPAQSYGGGPAQVPVP
GGFPGGQMPSQYPGGQSPYPGQPAAMTQGTQGTIRPASNFDAMRDAEILRKAMKGFGTDE
QAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWS
LRKAIQGAGTQERVLIEILCTRTNQEIRDIVRCYQLEFGRELERDIRSDTSGHFERLLVS
MCQGNRDESPSINHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSR
MANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVT
RSEIDLVQIKQMFTQMYQKTLSTMIASDTSGDYRKLLLAIVGQ
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtcatacccaggctaccccccgacaggctacccacctttccctggatatcctcctgca
ggtcaggagtcctctttccccacttcgggtcagtatccgtaccctagtggctttccacca
atgggaggaggtgcttacccaccagctccaagtggtggctacccaggagctggaggctac
ccctcacctggaggttatccagcccctgggggctatcctggaaccctaaatccagggggt
cctccatcctatcctggaggtcaaggctttggggccccacctggtggggcaggcttttct
ggctatccacagccacctgcacagtcttacggcggtggaccagcccaggttccagtccca
ggtggctttcctggagggcagatgccgtctcagtaccccggaggacagtctccctaccct
ggccagcctgctgcgatgactcagggcacccaaggaacaatccgcccagcctccaacttc
gatgctatgagagatgcagagattctccgcaaagcaatgaaggggtttgggactgatgag
caagcgattgtggatgtcgtgtctaaccgttccaatgaccagaggcaacaaattaaagca
gcttttaagaccatgtatggcaaggatttaattaaagatctcaagtcagagttgagtgga
aacatggaagaattaatccttgccctgttcatgcctcctacatactatgatgcctggagt
ttgcggaaggcgatacagggagcaggaactcaagagcgtgtgttgatagagattttgtgc
acaagaacaaatcaagaaatccgagacattgttagatgctatcaattagaatttggacgc
gagctcgagagggacattagatcggatacctcaggacatttcgaacggctcctcgtgtcc
atgtgccagggaaaccgtgacgagagcccaagtataaaccaccagatggcccaggaagat
gcccagcgcctctatcaggctggggaggggaggctagggacagacgaatcctgtttcaac
atgatcctcgccacaaggagcttccctcagctgagagccaccatggaggcttattccagg
atggctaatcgagatttgctaagcagtgtgagccgggaattttccggatacgttgaaagc
ggtttgaagaccatattgcagtgcgccctcaaccgccctgccttcttcgccgagcgactc
tactattccatgaaaggcgctggaacagatgactccaccctggtcaggattgtggtcact
cggagtgagattgacctcgttcagataaaacagatgttcacccagatgtatcagaagact
ctaagcacgatgattgcaagtgacaccagtggagattacaggaagctgctcctggccatc
gttggccagtga

DBGET integrated database retrieval system