KEGG   Rattus norvegicus (rat): 155918
Entry
155918            CDS       T01003                                 

Gene name
Lcp2
Definition
(RefSeq) lymphocyte cytosolic protein 2
  KO
K07361  lymphocyte cytosolic protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04380  Osteoclast differentiation
rno04611  Platelet activation
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    155918 (Lcp2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    155918 (Lcp2)
   04650 Natural killer cell mediated cytotoxicity
    155918 (Lcp2)
   04660 T cell receptor signaling pathway
    155918 (Lcp2)
   04664 Fc epsilon RI signaling pathway
    155918 (Lcp2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    155918 (Lcp2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    155918 (Lcp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    155918 (Lcp2)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   155918 (Lcp2)
SSDB
Motif
Pfam: SH2 SAM_2
Other DBs
NCBI-GeneID: 155918
NCBI-ProteinID: NP_569105
RGD: 619743
Ensembl: ENSRNOG00000005620
UniProt: Q920L0
Position
10
AA seq 525 aa
MALKNVPFRSEVLAWNPDNLADYFRKLNYRDCEKAVKKYHIDGARFLNLTENDIQKFPKL
RMPILSKLSQDINKNEERRSIFTRKPPVPRYPEEIEIHEEDDGGWSSFEDDYESPNDDDP
DGEDDGDYESPNEEEETLVDDAADYEPPPSNDEEALQNSILPAKPFPNTNSMYIDRPPTG
KVSQQPPVPPQRPMAALPPLPTGRNHSPNHEEPSRNRNHKTAKLPAPSIDRSTKPPLDRS
LAPPLDREPLLGKKPSDKPSAPLGREHLPKIQKPPLPPAMDRHERNERIGPLTARKPPVP
RHGRGPDRRDNDEDDVHQRPLPHPSLPSMSSNTFPSRSTKPSPKNTFPLPHMPGAISESN
IGFQQSASLPSYFSQGPSSRPPVRNEVRNLPLPVPNRPQPPSPGEEESPLDEEWYVSYIT
RPEAEAALRKINQDGTFLVRDSSKKTVNNPYVLMVLYKDKVYNIQIRYQEESQVYLLGTG
LRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGCL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggccttgaagaatgtcccctttcgctcagaggtcttagcctggaacccagacaacctt
gctgattatttcaggaagctgaactacagagactgtgagaaggctgtgaagaaataccac
attgatggcgctcggtttttgaacctgacagaaaacgacattcagaagtttcctaaactg
aggatgccgattctcagtaagttgagtcaagatatcaacaagaacgaagagagaaggagc
attttcacacgcaaacccccggttccacgatatcctgaggaaatagaaatccatgaagaa
gacgatggtggctggtcatcctttgaagatgactatgaaagtcccaatgacgacgatcca
gatggggaggatgatggtgactatgagtcccctaacgaggaggaagagacgctagtggac
gatgctgctgactatgagccgccaccctccaacgatgaggaggctctgcagaactccatc
ctgcctgccaagcctttccccaacaccaactccatgtacattgaccggcctcccaccggc
aaggtctcccagcagcctccggtgcccccgcagagaccaatggccgccctccctcccctg
ccaacaggccggaatcactcgcccaaccatgaagaacctagcagaaatcggaaccataaa
acagcaaagctgcctgctccatcaatagacagaagcacaaaacctcccctggaccgctca
ttggctcctcctcttgaccgagagcccttactgggaaagaaaccctctgataagccctcc
gctccactgggaagggagcatttacccaagatacagaagcctcctttgccgccagccatg
gacagacacgaaagaaatgaaagaatcggacccctgacagcaaggaagccaccagttcca
aggcatggaaggggaccagacagaagagacaatgatgaagatgatgtgcaccagaggcct
ttgccacacccatcactaccttctatgagctccaacacatttccttcgagatctaccaag
cccagccccaagaacacattcccattgcctcacatgccgggagccatctcagaaagtaac
attggctttcagcagagtgcctccctgccatcatacttctctcaaggtcccagcagcagg
ccacctgtcagaaatgaagtcagaaacttacctttaccagttccaaacaggcctcagcct
ccatctcctggggaagaagagtctccattagacgaagaatggtatgtctcttatattacc
cggccagaggcagaagctgctctgaggaagataaaccaggatggcaccttcctggttaga
gacagctctaagaagacagtgaacaatccatatgtcctcatggtgttgtacaaagacaaa
gtttacaacatccagatccgttaccaggaggaaagtcaagtctatttgttgggtactggg
cttcggggaaaagaggacttcctgtctgtatcagatattattgactacttcaggaaaatg
ccactgttactcattgatggaaaaaaccgagggtctagataccagtgcacactaacacat
gctgcaggctgtctgtag

DBGET integrated database retrieval system