KEGG   Rattus norvegicus (rat): 156117Help
Entry
156117            CDS       T01003                                 

Gene name
Casp12
Definition
(RefSeq) caspase 12
  KO
K04741  caspase 12 [EC:3.4.22.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04621  NOD-like receptor signaling pathway
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05020  Prion diseases
rno05161  Hepatitis B
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    156117 (Casp12)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    156117 (Casp12)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    156117 (Casp12)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    156117 (Casp12)
   05014 Amyotrophic lateral sclerosis (ALS)
    156117 (Casp12)
   05020 Prion diseases
    156117 (Casp12)
  09172 Infectious disease: viral
   05161 Hepatitis B
    156117 (Casp12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    156117 (Casp12)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     156117 (Casp12)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C14: caspase family
   156117 (Casp12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD HBD
Motif
Other DBs
NCBI-GeneID: 156117
NCBI-ProteinID: NP_569106
RGD: 621758
Ensembl: ENSRNOG00000033434
UniProt: Q920D5
Position
8q11
AA seq 420 aa AA seqDB search
MAAKRTHERDPIYKIKGLAKDMLDGVFDDLMDKNVLNGDELLKIGEGASLILSKAENLVE
SFFEKTEMAGKIFAGHIANSDKQLSLQFPSDDEEDELQKMFTPSSASESRGKVEDEEMEV
NVGVAHASHLMLTVPQGIQSTEVQDSLKLCSRDWFCTMKTERAEEIYPVMEKEGRTRLAL
IICNKKFDYLFDRDDAETDILNMKELLQNLGYSVVIKENLTAQEMETELMKFAGRPEHQS
SDSTFLVFMSHGILEGICGVKHRNKKPDVLHDDTIFTIFNNSNCPSLRNKPKILIMQACR
GRHTGTIWVSTSKGIATADTDEECVLSHRWNNSITKAHVETDFIAFKSSTPHNISWKVGK
SGSLFISKLIDCFKKYCWCYHLEEIFRKVQYSFEVPGELTQMPTIERVSMTRYFYLFPGN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaagagaacacatgaaagggatccaatctacaagatcaaaggtttggccaag
gacatgctggatggagtttttgatgacctgatggacaaaaatgttttaaatggcgatgag
ttactcaaaatcggagaaggagcgagcttaatcctgagcaaagctgagaacctggttgaa
agtttctttgagaaaacagaaatggcaggaaaaatatttgcaggtcacattgccaattcc
gacaaacagctgagtttacaatttccttctgatgatgaagaggatgaacttcagaaaatg
tttacaccatcttctgcatcagaatccaggggaaaagtagaagatgaagaaatggaggta
aatgttggagtggcccatgcatcacatctaatgcttacagttcctcagggaatccagagc
acagaagtacaggattcactgaagctatgttctcgtgattggttttgtacgatgaagaca
gaaagggcagaagagatatatccagtgatggagaaggaaggccgaacccgcctggccctc
atcatctgcaacaaaaagtttgactatctttttgatagagatgatgctgagactgacatt
ttgaacatgaaagaactacttcaaaatcttggatactcagtggtgataaaggaaaacctt
acagctcaggaaatggagacagaattaatgaagtttgctggccgtccagagcaccagtcc
tccgacagcacattcctggtctttatgtcccacggcatcctggaaggaatctgtggggtg
aagcacagaaacaaaaagccagatgttcttcatgatgacactatcttcaccattttcaac
aattctaactgtccgagtctgagaaacaaacccaagattctcatcatgcaagcctgcaga
ggcagacatactggtactatttgggtatccacaagcaaagggatagccactgctgataca
gatgaggaatgtgtgttgagccatagatggaataatagtataacaaaggcccatgtggag
acagatttcattgctttcaaatcttctaccccacataacatttcttggaaggtaggcaag
agtggctctctcttcatttccaaactcattgactgcttcaaaaagtattgttggtgttat
catttggaagaaattttccgaaaggttcaatactcatttgaggtcccaggtgaactgacc
cagatgcccaccattgagagagtatctatgacacgctacttctaccttttccctggaaat
taa

DBGET integrated database retrieval system