KEGG   Rattus norvegicus (rat): 156726
Entry
156726            CDS       T01003                                 

Gene name
Runx3
Definition
(RefSeq) runt-related transcription factor 3
  KO
K09279  runt-related transcription factor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04658  Th1 and Th2 cell differentiation
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    156726 (Runx3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    156726 (Runx3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    156726 (Runx3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    156726 (Runx3)
SSDB
Motif
Pfam: Runt RunxI
Other DBs
NCBI-GeneID: 156726
NCBI-ProteinID: NP_569109
RGD: 620082
Ensembl: ENSRNOG00000054217
UniProt: Q91ZK1
Position
5q36
AA seq 409 aa
MRIPVDPSTSRRFTPPSTAFPCGGGGGGKMGENSGALSAQAAAGPGGRTRPEVRSMVDVL
ADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSA
ELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPRE
PRRHRQKIEDQTKAFPDRFGDLRMRVTPSTPSPRGSLSTTSHFSSQAQTPIQGSSDLNPF
SDPRQFDRSFPTLQSLTESRFPEGRMHYPGAMSAAFPYSATPSGTSLGGLSVAGMPASSR
FHHTYLPPPYPGAPQSQSGPFQANPAPYHLFYGTSSGSYQFSMAAAGGGERSPTRMLTSC
PTGASVSAGNLMNPSLGQADGVEADGSHSNSPTALSTPGRMDEAVWRPY
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgcgtattcccgtagacccaagcaccagccgccgcttcactcccccctccacggccttc
ccctgcggcggcggcggcggcggcaagatgggcgagaacagcggcgcgctgagcgcgcag
gcggccgcgggccccggcggccgcacccggcccgaagtgcgctcgatggtggacgtgctg
gccgaccacgcgggagagctcgtgcgcaccgacagccccaacttcctctgctccgtgctg
ccctcgcactggcgctgcaacaagacgctgccggtcgccttcaaggtggtggcactgggg
gatgttcctgatggaacggtggtgaccgtgatggcgggcaatgacgagaattactccgcc
gagctgcgcaacgcttccgctgtcatgaagaaccaagtggcccggttcaacgacctccgc
ttcgtgggccgcagcgggcgagggaagagcttcacgctcacaatcaccgtgttcaccaac
cctacccaagtggccacctaccaccgagccatcaaggttactgtggatggaccccgggaa
ccccgacggcaccggcagaagatagaggaccagaccaaagccttccccgaccgcttcgga
gacctgcgcatgcgtgtaacaccaagcacacccagcccccgtggctctctcagcaccacg
agccacttcagcagccaggcccagaccccaatccaaggctcctcagacctgaaccccttc
tcggacccccgccagtttgatcgctccttccctacgctgcaaagcctcacagagagccgc
ttcccggagggaaggatgcactacccgggagccatgtctgccgccttcccctacagtgcc
acaccatcgggaaccagcctgggcggcctgagcgtggccggcatgccggccagcagccgc
ttccaccacacctacctccctccgccctacccgggggccccgcagagtcagagcgggccc
tttcaggccaaccctgcgccctaccacctcttctatggcacctcctccggctcctaccag
ttctccatggcagctgccggaggtggcgagcgctcgcccacccgcatgctgacctcctgc
cccaccggcgcttcggtgtcagcaggcaatctcatgaaccccagcctgggccaggctgat
ggcgtggaagccgacggcagtcacagcaactcgcccacggccctgagcacaccgggccgc
atggacgaggccgtgtggcggccctactga

DBGET integrated database retrieval system