KEGG   Rattus norvegicus (rat): 156767Help
Entry
156767            CDS       T01003                                 

Gene name
Tnfrsf1b, Tnfr2
Definition
(RefSeq) TNF receptor superfamily member 1B
  KO
K05141  tumor necrosis factor receptor superfamily member 1B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04668  TNF signaling pathway
rno04920  Adipocytokine signaling pathway
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    156767 (Tnfrsf1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    156767 (Tnfrsf1b)
   04061 Viral protein interaction with cytokine and cytokine receptor
    156767 (Tnfrsf1b)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    156767 (Tnfrsf1b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    156767 (Tnfrsf1b)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    156767 (Tnfrsf1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    156767 (Tnfrsf1b)
   04090 CD molecules [BR:rno04090]
    156767 (Tnfrsf1b)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   156767 (Tnfrsf1b)
CD molecules [BR:rno04090]
 Proteins
  156767 (Tnfrsf1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6
Motif
Other DBs
NCBI-GeneID: 156767
NCBI-ProteinID: NP_569110
RGD: 621238
Ensembl: ENSRNOG00000016575
UniProt: Q80WY6
Position
5q36
AA seq 474 aa AA seqDB search
MAPAALWVALVVELQLWATGHTVPAKVVLTPYKPEPGNQCQISQEYYDKKAQMCCAKCPP
GQYAKHFCNKTSDTVCADCAAGMFTQVWNHLHTCLSCSSSCSDDQVETHNCTKKQNRVCA
CNADSYCALKLHSGNCRQCMKLSKCGPGFGVARSRTSNGNVICSACAPGTFSDTTSSTDV
CRPHRICSILAIPGNASTDAVCASESPTPSAVPRTIYVSQPEPTRSQPMDQEPGPSQTPH
IPVSLGSTPIIEPSITGGISLPIGLIVGLTTLGLLMLGLANCFILVQRKKKPSCLQRETM
VPHLPDDKSQDAIGLEQQHLLTTAPSSSSSSLESSASAGDRRAPPGGHPQARVTAEAQGS
QEACAGSRSSDSSHGSHGTHVNVTCIVNVCSSSDHSSQCSSQASTTVGDPDANPSGSPKD
EQVPFSQEECPSQSQWETTETLQNHDKPFPLGVPDVGMKPNQPGWYDQIAVKVP
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgccgccctctgggtcgcgctggtcgtcgaactgcagctgtgggccaccggg
cacacagtgcccgccaaggttgtcttgacaccctacaagccagaacctgggaaccagtgc
cagatctcacaggagtactatgacaagaaggctcagatgtgctgtgctaagtgtccccct
ggccagtatgcaaaacacttctgcaacaagacttcagacaccgtgtgtgcggactgtgcg
gcaggcatgtttacccaggtctggaaccatctgcatacatgcctgagctgcagttcttcc
tgtagtgatgaccaggtggagacccacaactgcactaaaaaacagaaccgagtgtgtgct
tgcaacgctgacagttactgtgccttgaaattgcattctgggaactgtcgacagtgcatg
aagctgagcaagtgtggccctggcttcggagtggcccgttcaagaacctcaaatggaaac
gtgatatgcagtgcctgtgccccagggacgttctctgacaccacatcatccacagatgtg
tgcaggccccaccgcatttgtagcatcctggctattcctggaaatgcaagcacagatgca
gtctgtgcatccgagtccccaactccaagcgctgttccaaggacaatctacgtatctcag
ccagagcccacaagatcccagcccatggatcaagagccagggcctagccaaactccacac
atccctgtgtccttgggttcaacccccatcattgaaccaagcatcacgggtggcatctct
cttccaattggtctgatcgttggactgacaactctgggtctgctgatgttaggactggcg
aactgcttcatcctggtgcagaggaaaaagaagccctcctgcctacaacgagaaaccatg
gtgcctcatctgcctgatgacaaatcccaggatgcaataggccttgaacagcagcaccta
ttgaccacagcacccagttccagcagcagctccctggagagctcagccagcgctggggac
aggagagcgccccctgggggtcatccccaagcaagagtcacagcggaggcccaagggtct
caggaagcctgtgccggctccaggagttcagattcttcccatggcagccacgggacccat
gtcaacgtcacctgcatcgtgaacgtctgtagcagctctgaccacagctctcagtgttct
tcccaagccagcaccacggtgggagacccagatgctaacccttcagggtctccaaaggat
gagcaggtccccttttcccaggaggagtgtccctctcagtcccagtgggagaccacagag
acactgcagaaccatgacaagccctttccccttggtgtgcctgatgtgggtatgaagccc
aaccaaccaggctggtatgaccagattgctgtcaaagtgccttga

DBGET integrated database retrieval system