KEGG   Rattus norvegicus (rat): 157074
Entry
157074            CDS       T01003                                 

Gene name
Sdha
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rno_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    157074 (Sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    157074 (Sdha)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    157074 (Sdha)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    157074 (Sdha)
   05012 Parkinson disease
    157074 (Sdha)
   05014 Amyotrophic lateral sclerosis
    157074 (Sdha)
   05016 Huntington disease
    157074 (Sdha)
   05020 Prion disease
    157074 (Sdha)
   05022 Pathways of neurodegeneration - multiple diseases
    157074 (Sdha)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    157074 (Sdha)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    157074 (Sdha)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     157074 (Sdha)
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Other DBs
NCBI-GeneID: 157074
NCBI-ProteinID: NP_569112
RGD: 621557
Ensembl: ENSRNOG00000013331
UniProt: Q920L2
Position
1
AA seq 656 aa
MAGVGAVSRLLRGRRLALAGATRGFHFSVGESKKASAKVSDAISTQYPVVDHEFDAVVVG
AGGAGLRAAFGLSEAGFNTACLTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVK
GSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLKFGKGGQAHR
CCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIR
AKNTIIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLIT
EGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQL
HHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLKHVNGQ
DQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDKVPPIKANA
GEESVMNLDKLRFADGSVRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKVSQLYGDLQH
LKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEYDYSK
PIEGQQKKPFAEHWRKHTLSYVDTKTGKVTLDYRPVIDKTLNEADCATVPPAIRSY
NT seq 1971 nt   +upstreamnt  +downstreamnt
atggccggggttggcgcagtttcgagacttcttcgcgggcggcgcttggctctagctggg
gcgactcgtggctttcacttctctgttggtgagagcaagaaggcatccgctaaagtttca
gacgcgatttctacccagtaccccgtggtggaccatgagtttgatgctgtggttgtaggt
gcaggcggggcaggcttgcgagctgcattcggcctttctgaggcaggctttaacacggca
tgccttacaaagctctttcctacccgctcacatactgttgcagcacagggaggtatcaat
gctgccctggggaacatggaagaggacaactggagatggcatttctatgacaccgtgaaa
ggctctgactggctgggggatcaggatgccatccattacatgacagagcaagctcctgcc
tccgtggttgagctagaaaattacggtatgccgtttagcaggactgaagatgggaggatt
tatcagcgtgcatttggtggacagagcctcaagttcgggaaaggcgggcaggcccatcgg
tgttgctgtgtcgctgatcggacgggccactcactcttacacaccttgtatggacgatct
ctgcggtatgacaccagttattttgtggagtatttcgcactggatcttctgatggaaaat
ggggagtgccgtggtgtcattgcactgtgcatagaagatgggtccatacaccgaataaga
gcaaagaacactattattgctactgggggctatgggcgaacctacttcagctgtacttct
gcccacaccagcacaggggacggcacagccatggtcactcgggctggtttaccttgccag
gacttagaatttgttcagttccaccccacaggtatctatggtgctggctgcctcatcaca
gaagggtgccgtggagagggaggcattctcatcaacagccaaggcgaaaggttcatggag
agatatgcccctgttgccaaggacctagcatcaagagatgttgtgtctcgatccatgact
ctcgagatccgtgaaggaagaggctgtggccctgagaaggatcacgtctacctgcagttg
caccatctgccccctgagcagctggccacgcgtctgcctgggatctcagagacggccatg
atcttcgccggcgtggatgtcaccaaggagcccattccagtccttcccactgtgcattac
aacatgggcgggattcccactaactacaagggacaggtgctgaagcacgtgaacggccag
gatcagattgtgcctggtctgtacgcctgtggggaggctgcctgcgcctcagtgcatggt
gccaaccggcttggagcaaactctcttttggaccttgtcgtctttggccgagcctgtgcc
ctgagcattgcagaatcttgcaggcctggagataaagttcctccgattaaggcaaatgct
ggagaagagtcggttatgaatcttgacaagttgagatttgctgatggaagtgtaagaaca
tcagagctgcgcctcagcatgcagaagtcgatgcagagccatgccgccgtgttccgtgtg
ggaagtgtgctgcaagaaggctgtgaaaaagtcagccagctctatggagacctacagcat
ctgaagacgtttgacaggggaatggtctggaacacagacctggtggagacgctggagctg
cagaatctgatgctgtgcgcactgcagaccatatatggtgcggaagcacggaaggagtca
cggggagctcatgccagggaagattacaaggtgcggattgatgagtatgattactccaag
cccatcgagggccagcagaagaagccatttgcggaacactggaggaagcacaccctctca
tatgtggacaccaagactgggaaggttactttggattacagacctgttattgacaagacc
ttgaatgaggctgactgtgctactgtacctcctgctatccgttcctactga

KEGG   Rattus norvegicus (rat): 289217
Entry
289217            CDS       T01003                                 

Gene name
Sdhc
Definition
(RefSeq) succinate dehydrogenase cytochrome b560 subunit, mitochondrial
  KO
K00236  succinate dehydrogenase (ubiquinone) cytochrome b560 subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rno_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    289217 (Sdhc)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    289217 (Sdhc)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    289217 (Sdhc)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    289217 (Sdhc)
   05012 Parkinson disease
    289217 (Sdhc)
   05014 Amyotrophic lateral sclerosis
    289217 (Sdhc)
   05016 Huntington disease
    289217 (Sdhc)
   05020 Prion disease
    289217 (Sdhc)
   05022 Pathways of neurodegeneration - multiple diseases
    289217 (Sdhc)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    289217 (Sdhc)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    289217 (Sdhc)
SSDB
Motif
Pfam: Sdh_cyt
Other DBs
NCBI-GeneID: 289217
NCBI-ProteinID: NP_001005534
RGD: 1359454
Ensembl: ENSRNOG00000003163
UniProt: Q641Z9
Position
13
AA seq 169 aa
MAALLLRHIGRHCLRAHLSSQLCIRNAAPLGTTAKEEMARFWNKNTSSNRPVSPHLTIYR
WSLPMAMSVCHRGSGIAMSGGVSLFGLSALLLPGNFESYLMLVKSLCLGPALIHAAKFVL
VFPLMYHSLNGVRHLMWDLGKGLSISQVQLSGVTVLVLAVLSSAGLAAI
NT seq 510 nt   +upstreamnt  +downstreamnt
atggctgcgctcttgctgagacacatcggccgccattgcctccgagcccaccttagttct
cagctctgtatcagaaatgctgctcctttgggaaccacagctaaggaagaaatggcacgg
ttctggaataagaacacgagttccaaccgtcctgtctctccccatttgactatctacagg
tggtctcttcccatggcaatgtctgtttgccaccgaggctctgggatagccatgagtgga
ggggtctctctttttggcctgtcggcactgctgcttcctgggaactttgagtcgtatctg
atgcttgtgaagtccctgtgtttggggccagcgctgatccatgcagccaagttcgtgctt
gtctttcctctcatgtaccactcattgaatggggtccgacacttgatgtgggacctaggg
aaaggcctgtcgatttcccaggtccagttgtctggagtgacggtcttggttcttgcagtg
ctgtcctctgcaggactggcagccatatga

KEGG   Rattus norvegicus (rat): 298596
Entry
298596            CDS       T01003                                 

Gene name
Sdhb
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial precursor
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rno_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    298596 (Sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    298596 (Sdhb)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    298596 (Sdhb)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    298596 (Sdhb)
   05012 Parkinson disease
    298596 (Sdhb)
   05014 Amyotrophic lateral sclerosis
    298596 (Sdhb)
   05016 Huntington disease
    298596 (Sdhb)
   05020 Prion disease
    298596 (Sdhb)
   05022 Pathways of neurodegeneration - multiple diseases
    298596 (Sdhb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    298596 (Sdhb)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    298596 (Sdhb)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     298596 (Sdhb)
SSDB
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_7 Fer4_18
Other DBs
NCBI-GeneID: 298596
NCBI-ProteinID: NP_001094009
RGD: 1308598
Ensembl: ENSRNOG00000007967
UniProt: P21913
Position
5
AA seq 282 aa
MAAVVGVSLKRGFSATALGRVGLQFQACREAQTAAAAAPRIKTFAIYRWDPDKAGDKPRM
QTYKVDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRID
TDLGKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDRE
KLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAKLQDPF
SLYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKRALA
NT seq 849 nt   +upstreamnt  +downstreamnt
atggcggcggtggtcggggtctccttgaagcgcggcttttcggctacggctctcggcaga
gtcggcctgcagtttcaggcctgccgagaggcacagacagctgctgctgcagctcccaga
atcaaaaccttcgccatttaccgatgggacccggacaaggctggagataaacctcgaatg
cagacatacaaggtggatctgaataagtgtggaccgatggtgctggatgctctaatcaag
attaagaatgaaatcgattctactttgaccttccgaagatcatgcagagaagggatctgt
ggctcttgtgccatgaacatcaacggaggcaacacgctggcatgcacgcgcaggatcgac
acagaccttggcaaagtctcgaaaatataccctcttccgcatatgtatgtgatcaaggat
ctagtccctgacttgagtaacttctatgcacaatacaaatccattgagccctatctgaag
aagaaggatgagtcccaggagggcaagcaacagtatctgcaatccatcgaggaccgggag
aagctggacggattgtatgagtgcatcctgtgtgcctgctgcagcaccagctgtcccagt
tactggtggaacggagacaagtacctggggcctgcagttctcatgcaggcttatcgctgg
atgatcgactccagagatgaattcacagaggagcgcctggccaagctgcaggaccccttc
tctctctaccgctgccacaccatcatgaactgtacacagacctgccccaagggtctgaat
ccaggaaaagcaattgcagaaatcaagaagatgatggcgacctacaaggagaagcgggca
ttggcttaa

KEGG   Rattus norvegicus (rat): 363061
Entry
363061            CDS       T01003                                 

Gene name
Sdhd
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
  KO
K00237  succinate dehydrogenase (ubiquinone) membrane anchor subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rno_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    363061 (Sdhd)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    363061 (Sdhd)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    363061 (Sdhd)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    363061 (Sdhd)
   05012 Parkinson disease
    363061 (Sdhd)
   05014 Amyotrophic lateral sclerosis
    363061 (Sdhd)
   05016 Huntington disease
    363061 (Sdhd)
   05020 Prion disease
    363061 (Sdhd)
   05022 Pathways of neurodegeneration - multiple diseases
    363061 (Sdhd)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    363061 (Sdhd)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    363061 (Sdhd)
SSDB
Motif
Pfam: CybS
Other DBs
NCBI-GeneID: 363061
NCBI-ProteinID: NP_942083
RGD: 735231
Ensembl: ENSRNOG00000022980
UniProt: Q6PCT8
Position
8
AA seq 159 aa
MAVLLKLGVLCSGQGARALSLRSRAVRPAFVSAFLQDQPTPGWRGTQHIHLSPSHQSGSK
AASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGIGQVVTDYVHGDAL
QKATKAGLLAVSALTFAGLCYFNYHDVGICRAVAMLWKL
NT seq 480 nt   +upstreamnt  +downstreamnt
atggcggttctcttaaagctgggcgttctctgcagtggccaaggagctcgagctctgtca
ctccgaagccgggcggtcagacctgcttttgtgtccgcatttctccaggaccagcctacc
ccaggatggcgtggcacccagcacatccacctgtcaccaagccaccagtctggttccaag
gccgcatctctccactggaccagtgagagggttgtcagtgttttgctcttgggcctgatt
ccagctgggtacttgaatccctgctctgtggtggactactctctggctgcagccctcacc
ctgcacagtcactggggcattggacaagtggttactgactacgttcatggggacgcactg
cagaaggctaccaaggcaggcctcttggcagtctcagctttgacctttgctgggctttgc
tacttcaattaccacgatgtaggcatctgcagagcggttgccatgctgtggaagctctga

DBGET integrated database retrieval system