KEGG   Rattus norvegicus (rat): 161452
Entry
161452            CDS       T01003                                 

Gene name
Lef1
Definition
(RefSeq) lymphoid enhancer-binding factor 1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04520  Adherens junction
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05132  Salmonella infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05213  Endometrial cancer
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05217  Basal cell carcinoma
rno05221  Acute myeloid leukemia
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    161452 (Lef1)
   04390 Hippo signaling pathway
    161452 (Lef1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    161452 (Lef1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    161452 (Lef1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    161452 (Lef1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    161452 (Lef1)
   05225 Hepatocellular carcinoma
    161452 (Lef1)
   05226 Gastric cancer
    161452 (Lef1)
   05216 Thyroid cancer
    161452 (Lef1)
   05221 Acute myeloid leukemia
    161452 (Lef1)
   05217 Basal cell carcinoma
    161452 (Lef1)
   05215 Prostate cancer
    161452 (Lef1)
   05213 Endometrial cancer
    161452 (Lef1)
   05224 Breast cancer
    161452 (Lef1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    161452 (Lef1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    161452 (Lef1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    161452 (Lef1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    161452 (Lef1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    161452 (Lef1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    161452 (Lef1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 161452
NCBI-ProteinID: NP_569113
RGD: 620241
Ensembl: ENSRNOG00000010121
UniProt: Q9QXN1
Position
2
AA seq 397 aa
MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESE
IIPASNGHEVVGQTQSSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNS
DPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSEVNPKQ
GMSRHPPAPEMPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQAYPSSLSGDTSMSRF
SHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPEHEQRKEQEPKRPHIKKP
LNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQL
YPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgccccaactttccggaggaggcggtgggggggacccggaactctgcgccaccgatgag
atgatccccttcaaggacgagggcgatccccagaaggagaagattttcgccgagatcagt
caccccgaagaggagggcgacttagcagacatcaagtcatccttggtaaacgagtccgaa
atcatcccagccagcaacgggcatgaggtggtcggacaaacacagtcctctcaggagccc
taccacgacaaggccagagagcacccggatgacggaaagcatccggacggaggtctatat
aacaagggcccctcctactccagttactctggctacatcatgatgcccaatatgaatagc
gacccatacatgtcaaatggatccctttctccacccatcccgaggacctcaaataaagtg
ccggtggtgcagccatctcacgcggtccaccccctcacgcccctcatcacgtacagcgac
gagcacttttctccagggtctcacccgtcacacatcccgtcagaggtcaaccccaagcaa
ggcatgtctagacacccaccagctcctgaaatgcccaccttctaccccctgtctccaggc
ggcgttggacagatcaccccacccctcggctggcaaggtcagcctgtttatcccatcacg
ggtgggttcaggcaagcctacccatcttcactttcaggggacacttccatgtccaggttt
tcccatcacatgattcctgggccccctggcccccacacaactggcatccctcatccagca
attgtaacacctcaggtcaaacaggagcacccccacacggacagcgacctaatgcacgtg
aagcctgagcacgaacagagaaaggaacaggagcctaaaagacctcatattaagaagcct
ctgaatgctttcatgttatacatgaaagaaatgagggcgaatgtcgtagccgagtgtacg
ctaaaggagagcgcagctatcaaccagatcctgggcagaaggtggcacgccctctcccgg
gaagagcaggccaaatattatgaattagcgcggaaagaaagacagctacatatgcagctc
tatccaggctggtcagcgagagacaattatggcaagaagaagaagaggaagagagagaag
ctacaggaatctacttcaggtacaggtcccagaatgacagctgcctacatctga

KEGG   Rattus norvegicus (rat): 312451
Entry
312451            CDS       T01003                                 

Gene name
Tcf7l1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04520  Adherens junction
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05132  Salmonella infection
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05213  Endometrial cancer
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05217  Basal cell carcinoma
rno05221  Acute myeloid leukemia
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    312451 (Tcf7l1)
   04390 Hippo signaling pathway
    312451 (Tcf7l1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    312451 (Tcf7l1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    312451 (Tcf7l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    312451 (Tcf7l1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    312451 (Tcf7l1)
   05225 Hepatocellular carcinoma
    312451 (Tcf7l1)
   05226 Gastric cancer
    312451 (Tcf7l1)
   05216 Thyroid cancer
    312451 (Tcf7l1)
   05221 Acute myeloid leukemia
    312451 (Tcf7l1)
   05217 Basal cell carcinoma
    312451 (Tcf7l1)
   05215 Prostate cancer
    312451 (Tcf7l1)
   05213 Endometrial cancer
    312451 (Tcf7l1)
   05224 Breast cancer
    312451 (Tcf7l1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    312451 (Tcf7l1)
   05165 Human papillomavirus infection
    312451 (Tcf7l1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    312451 (Tcf7l1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    312451 (Tcf7l1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    312451 (Tcf7l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    312451 (Tcf7l1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    312451 (Tcf7l1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 DDAH_eukar
Other DBs
NCBI-GeneID: 312451
NCBI-ProteinID: NP_001101335
RGD: 1311671
Ensembl: ENSRNOG00000014753
UniProt: F1M1R9
Position
4
AA seq 587 aa
MPQLGGGRGGGAGGGGGGSGAGATSGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRDL
DEVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPAYPGY
PFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPVL
QHPHHLQHPLTPLITYSNDHFSPASPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAV
GQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLP
TSGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMR
AKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHAQLYPTWSARDNYGK
KKKRKREKQLSQTQSQQQIQEAEGALVSKSKKPCIQYLPPEKPCDSPASSHGSTLDSPAT
PSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKATASNSSQMGSQPPL
LSRPLPLGSMPTALLTSPPSFPATLHAHQTLPVLQAQPLSLVTKSAH
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgccccagctcggtggtggccgcggtggcggcgccggcgggggaggcggtggctccgga
gccggggcaaccagtggaggggacgacctcggagcgaacgacgagctgatccccttccag
gacgaggggggcgaagagcaggagccgagcagcgacagcgcttcggcgcagagggatctg
gatgaggtcaagtcgtccctggtcaacgaatcggagaatcagagcagtagctcggactcc
gaggcggagaggcgcccgcagcccgcccgggacgctttccagaagccgcgcgactatttc
gccgaagtgagaaggccccaggacggcgctttctttaagggacctgcgtaccctgggtac
cccttcctgatgattccagacctgagcagcccatacctctccaatggacccctgtctcct
ggtggagcgcgcacctacctgcagatgaaatggcccctcctcgatgtcccctccagcgct
acagtcaaggacacaagatcaccatctccagcacacttgtccaacaaagtccctgttctt
cagcatcctcatcacctacagcacccgctgacccctctcatcacctacagcaacgaccac
ttctcccccgcgtcccctcccacacatctgtccccagagatcgacccaaagacaggtatc
ccccggccccctcacccatctgagctgtcaccgtattacccactgtctccaggagctgtt
ggacaaatcccccatcccctcggctggctcgtcccacagcaaggacagcccatgtactca
ctccctcctggtggtttccggcacccttaccctgcccttgccatgaatgcttcaatgtcc
agcctggtctcaagtcggttctccccacacatggtggctcctgcccatcctggtctgccc
acctcaggaatcccccaccctgccatcgtctcccccattgtgaagcaggagccagcgccc
cccagcctgagccctgcagtgagtgcgaaatcccccgttaccgtgaaaaaggaagaggag
aagaagcctcacgtgaaaaagcctctcaatgccttcatgttgtatatgaaggagatgagg
gcaaaggtggtggccgagtgtaccctgaaggaaagtgcagccattaaccaaatcctggga
agaaagtggcacaacctgtcaagagaagaacaggccaaatactatgaacttgcccggaaa
gaacggcagcttcacgcgcagctctacccaacctggtcagcccgggacaactatggtaag
aagaagaagaggaagagggaaaagcagctgtcacagacacagtctcagcagcaaatccag
gaggcagagggtgctctggtctctaagagcaagaagccatgcattcagtacctgccccct
gagaagccttgtgatagccctgcgtcttcccatggcagcacgttggactcccctgcgact
ccctccgcagccctggcgtcaccagctgcccctgcggctactcactccgagcaagcccag
cccctgtcactcaccaccaaaccggagacccgggcccagctggctctccactcagctgcc
ttcctgtcagctaaggccacagccagcaactccagccagatgggcagccagcccccactc
ctatccaggcccttgcccttgggctctatgcccaccgctctgctgacctctcccccttct
ttcccagccacgctccatgcccaccagaccctccccgtgctacaggcccagcctctttcc
ttggtcaccaagtctgcccactaa

KEGG   Rattus norvegicus (rat): 363595
Entry
363595            CDS       T01003                                 

Gene name
Tcf7
Definition
(RefSeq) transcription factor 7 isoform X2
  KO
K02620  transcription factor 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04520  Adherens junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05132  Salmonella infection
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05213  Endometrial cancer
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05217  Basal cell carcinoma
rno05221  Acute myeloid leukemia
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    363595 (Tcf7)
   04390 Hippo signaling pathway
    363595 (Tcf7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    363595 (Tcf7)
   04550 Signaling pathways regulating pluripotency of stem cells
    363595 (Tcf7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    363595 (Tcf7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    363595 (Tcf7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    363595 (Tcf7)
   05225 Hepatocellular carcinoma
    363595 (Tcf7)
   05226 Gastric cancer
    363595 (Tcf7)
   05216 Thyroid cancer
    363595 (Tcf7)
   05221 Acute myeloid leukemia
    363595 (Tcf7)
   05217 Basal cell carcinoma
    363595 (Tcf7)
   05215 Prostate cancer
    363595 (Tcf7)
   05213 Endometrial cancer
    363595 (Tcf7)
   05224 Breast cancer
    363595 (Tcf7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    363595 (Tcf7)
   05165 Human papillomavirus infection
    363595 (Tcf7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    363595 (Tcf7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    363595 (Tcf7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    363595 (Tcf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    363595 (Tcf7)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    363595 (Tcf7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 363595
NCBI-ProteinID: XP_006246424
RGD: 1305894
Ensembl: ENSRNOG00000005872
Position
10
AA seq 419 aa
MPQLDSGGGGTGAGDDLGAPDELLAFQDEGEEQDDKNRDSAAGPERDLAELKSSLVNESE
GAAAGAGVPSPGVRVHGEAEGAPEALGREHTSQRLFSDKLPESLEDGLKAPECASGMYKE
TVYSAFNLLMHYPPASGTGQHPQPQPPLHNKPGQPPHGVPQLSPLYEHFSSPHPTPAPAD
ISQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAA
PGAPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPSSGKQELQPYDRNLKTQAEPKAEKEAK
KPIIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKE
RQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgccgcagctggactcgggcgggggcggcacgggagcaggagacgacctcggcgcgccg
gacgagctcttggccttccaagacgaaggcgaggaacaggacgataagaatcgcgacagc
gccgcgggccccgagcgggacctggcggagctcaagtcctcactggtgaatgagtctgaa
ggcgcggccgcaggcgccggggtcccgagtcccggcgtccgagtccatggagaagccgaa
ggagcgcccgaggccctgggacgagagcacacttcgcagagacttttctcggacaaactt
ccagagtccctagaggacggcctgaaggccccggagtgtgccagtggcatgtacaaagag
actgtctactctgccttcaatctgctcatgcactacccaccggcctcgggaacggggcag
catccgcagcctcagcccccgctgcataacaagcccggccagcccccacatggcgtcccc
caactttctccactctacgaacatttcagcagtccacaccctacccctgcaccagcggac
atcagccagaagcaaggagttcacagaccgctgcagacccctgatctctctggattttat
tctctgacctcaggcagcatgggacagctcccccatactgtgagctggcccagccctcct
ctctaccccctgtccccttcctgcggatatagacagcacttccctgcccccactgcagcc
cctggcgccccctatcccaggttcacccacccgtccttgatgctgggatctggtgtacct
ggacacccagcagccatccctcacccggccattgtgccctcctcagggaagcaggagctg
cagccatatgacagaaacctgaaaacacaggcagaacccaaggcagagaaggaggcgaag
aagccaatcatcaaaaagcccctcaatgctttcatgctttacatgaaggagatgagagcc
aaggtcattgcagagtgcacactcaaggagagcgctgccatcaaccagatcctgggtcgc
aggtggcatgcattatctcgagaagagcaagccaagtactatgagctggcccgcaaggaa
aggcagctgcacatgcagttatacccaggctggtcagcacgggataactacggaaagaag
aagaggcggtcaagggaaaagcatcaagaatccaccacaggaggaaaaagaaatgcattc
ggtacttacccggagaaggccgctgccccagccccgttccttccgatgacagtgctctag

KEGG   Rattus norvegicus (rat): 679869
Entry
679869            CDS       T01003                                 

Gene name
Tcf7l2
Definition
(RefSeq) transcription factor 7-like 2
  KO
K04491  transcription factor 7-like 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04520  Adherens junction
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05132  Salmonella infection
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05213  Endometrial cancer
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05217  Basal cell carcinoma
rno05221  Acute myeloid leukemia
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    679869 (Tcf7l2)
   04390 Hippo signaling pathway
    679869 (Tcf7l2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    679869 (Tcf7l2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    679869 (Tcf7l2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    679869 (Tcf7l2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    679869 (Tcf7l2)
   05225 Hepatocellular carcinoma
    679869 (Tcf7l2)
   05226 Gastric cancer
    679869 (Tcf7l2)
   05216 Thyroid cancer
    679869 (Tcf7l2)
   05221 Acute myeloid leukemia
    679869 (Tcf7l2)
   05217 Basal cell carcinoma
    679869 (Tcf7l2)
   05215 Prostate cancer
    679869 (Tcf7l2)
   05213 Endometrial cancer
    679869 (Tcf7l2)
   05224 Breast cancer
    679869 (Tcf7l2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    679869 (Tcf7l2)
   05165 Human papillomavirus infection
    679869 (Tcf7l2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    679869 (Tcf7l2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    679869 (Tcf7l2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    679869 (Tcf7l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    679869 (Tcf7l2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    679869 (Tcf7l2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 679869
NCBI-ProteinID: NP_001177981
RGD: 1583621
Position
1
AA seq 598 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKNSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAIQYLQMKWPLLDVQAGSLQSRQALKDARSPSP
AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPP
HHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSDLHEKKKPHIKKPLNAFMLYMKEMRA
KVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKK
KKRKRDKQPGETNDANTPKKCRALFGLDRQTLWCKPCRRKKKCVRYIQGEGSCLSPPSSD
GSLLDSPPPSPHLLGSPPQDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEAAHG
KASALCPNGALDLPPATLQPSMVPSSSLAQPSTSSLHSHNSLAGTQPQPLSLVTKSLE
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgccgcagttgaacggcggtggaggagatgacctaggcgctaacgacgaactgatctcc
ttcaaagacgaaggcgagcaggaggagaagaactcggaaaactcctcggcggagagggat
ttagccgatgtcaagtcgtcgttggtcaatgaatcagagacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcaatccggcagcactcattactctgcgtac
aaaacgattgaacaccagattgcaattcagtatcttcagatgaaatggcctctgctcgat
gtccaagcaggaagcctccagagcagacaagccctcaaggatgcccgctcaccttcgcca
gcacacatcgtttcgaacaaagtgccggtggtgcagcacccccaccatgtccacccactc
acacctctcatcacgtacagcaatgaacacttcaccccgggaaatccacctccgcactta
ccagctgacgtagaccccaaaacaggaattccacggcctccgcaccctccagatatctct
ccatattacccgctgtcgcccggcaccgtaggacaaatcccccatccgctaggatggtta
gtaccacagcaaggtcagcctgtgtacccaatcacgacaggaggattcagacacccctac
cccacagcgctgacagtcaacgcgtctatgtctaggttccctccccacatggtccctccc
catcacactctgcacacgaccggaatcccccacccggccattgtcacaccgacagtcaag
caggagtcctcacagagtgacgtcggctcactccatagctcagatctccatgagaagaaa
aagccccacataaagaagccccttaatgcattcatgttgtatatgaaggagatgagagcg
aaggtggtggctgagtgcacattgaaagagagtgcagccatcaaccagatcctcgggcgc
aggtggcacgccctgtccagggaagaacaggcaaagtactacgagctagcccggaaggaa
cgacagcttcacatgcagctgtaccctggctggtctgcacgggataactatggaaagaag
aagaagagaaaaagagacaagcagccgggggagaccaatgatgcaaatactccaaagaag
tgtcgggcactgttcgggcttgaccgacagactttatggtgcaaaccctgcaggagaaaa
aaaaagtgcgttcgctacatacaaggtgaaggcagctgcctcagcccaccctcttcagat
ggaagcttactagactcacctcccccctcaccgcatctgctaggctcccctccccaagac
gccaagtcacagactgagcagacacagccgctctcgctgtccctgaagcctgatcctctg
gcccacctgtccatgatgcctccaccacccgcgctcctgctggctgaagctgcccacggc
aaggcctctgccctctgtcccaacggggccctggacctgccacctgccactttgcagccg
tccatggtcccttcctcatcgctcgcacaaccatcaacttcttccttacattcccacaac
tcgctggctgggacgcaaccccagcctctgtctctggtgaccaagtctttagaatag

DBGET integrated database retrieval system