KEGG   Rattus norvegicus (rat): 170496
Entry
170496            CDS       T01003                                 

Gene name
Lcn2
Definition
(RefSeq) neutrophil gelatinase-associated lipocalin precursor
  KO
K21129  lipocalin 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    170496 (Lcn2)
SSDB
Motif
Pfam: Lipocalin Lipocalin_2 VDE
Other DBs
NCBI-GeneID: 170496
NCBI-ProteinID: NP_570097
RGD: 69408
Ensembl: ENSRNOG00000013973
UniProt: P30152
Structure
PDB: 
2K23

Position
3
AA seq 198 aa
MGLGVLCLALVLLGVLQRQAQDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAANA
VQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSY
PQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLG
LKDNNIVFSVPTDQCIDN
NT seq 597 nt   +upstreamnt  +downstreamnt
atgggcctgggtgtcctgtgtctggcccttgtcctgcttggggtcctgcagaggcaggcc
caggactcaactcagaacttgatccctgccccacctctgatcagtgtgcccctgcagcca
ggcttctggaccgaacggttccagggcaggtggttcgttgtcggcctggcagcgaatgcg
gtccagaaagaaagacaaagccgctttaccatgtacagcaccatctatgagctacaggaa
gacaatagctacaacgtcacttccatcctcgtcaggggccagggctgtcgctactggatc
agaacattcgttccaagctccaggcctggccagttcaccctggggaatattcacagctac
cctcagatacagagctacgatgtgcaagtggccgacactgactacgaccagtttgccatg
gtatttttccagaagacctctgaaaacaaacagtacttcaaagtcaccctgtacggaaga
accaaggggctgtccgatgaactgaaggagcgattcgtcagctttgccaagtctctgggc
ctcaaggataacaacatcgttttctctgttcccaccgaccaatgcattgacaactga

DBGET integrated database retrieval system