KEGG   Rattus norvegicus (rat): 170538Help
Entry
170538            CDS       T01003                                 

Gene name
Prkcd, Pkcd
Definition
(RefSeq) protein kinase C, delta
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04140  Autophagy - animal
rno04270  Vascular smooth muscle contraction
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04722  Neurotrophin signaling pathway
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    170538 (Prkcd)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    170538 (Prkcd)
   04625 C-type lectin receptor signaling pathway
    170538 (Prkcd)
   04666 Fc gamma R-mediated phagocytosis
    170538 (Prkcd)
   04062 Chemokine signaling pathway
    170538 (Prkcd)
  09152 Endocrine system
   04912 GnRH signaling pathway
    170538 (Prkcd)
   04915 Estrogen signaling pathway
    170538 (Prkcd)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    170538 (Prkcd)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    170538 (Prkcd)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    170538 (Prkcd)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    170538 (Prkcd)
   04931 Insulin resistance
    170538 (Prkcd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    170538 (Prkcd)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    170538 (Prkcd)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     170538 (Prkcd)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   170538 (Prkcd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C C1_2 zf-RING-like Zf_RING Kinase-like zf-RING_9 PHD DZR Haspin_kinase Pkinase_fungal DUF2318 APH FYVE_2 CxC3
Motif
Other DBs
NCBI-GeneID: 170538
NCBI-ProteinID: NP_579841
RGD: 67383
Ensembl: ENSRNOG00000016346
UniProt: P09215
Structure
PDB: 

Position
16p16
AA seq 673 aa AA seqDB search
MAPFLRISFNSYELGSLQAEDDASQPFCAVKMKEALTTDRGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEDPMSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQY
FLEDGDCKQSMRSEEEAMFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMS
PTFCDHCGTLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQKASR
KPETPETVGIYQGFEKKTAVSGNDIPDNNGTYGKIWEGSNRCRLENFTFQKVLGKGSFGK
VLLAELKGKERYFAIKYLKKDVVLIDDDVECTMVEKRVLALAWENPFLTHLICTFQTKDH
LFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHGKGIIYRDLKLDNVMLD
KDGHIKIADFGMCKENIFGENRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEML
IGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPAKRLGVTGNIRLHPF
FKTINWNLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQTAFKG
FSFVNPKYEQFLE
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgttcctgcgcatctccttcaattcctatgagctgggctccctgcaggcggag
gacgacgcaagccagcctttctgtgccgtgaagatgaaggaggcactcaccacagaccga
gggaagactctggtacagaagaagcccaccatgtaccctgagtggaagtcaacattcgac
gcccacatctatgaaggccgtgtcatccagatcgtgctgatgcgggcagctgaagacccc
atgtcggaggtgaccgtgggcgtgtcagtgctggctgagcgctgcaagaagaacaacggc
aaggctgagttctggctggacctgcagcctcaggccaaggtgctgatgtgtgtgcagtat
ttcctggaggatggggattgcaaacagtccatgcgtagtgaggaggaggccatgttccca
actatgaaccgccgtggagccattaaacaggccaagattcactacatcaagaaccacgag
ttcatcgccaccttctttgggcagcccaccttctgttctgtgtgcaaagagtttgtctgg
ggcctcaacaagcaaggctacaaatgcaggcaatgcaacgctgccatccataagaaatgc
atcgacaagattatcggccgctgcactggcactgctaccaatagccgggacaccatcttc
cagaaagaacgcttcaacatcgacatgcctcaccgattcaaggtctataactacatgagc
cccaccttctgtgaccactgtggcactttgctctggggattggtgaaacagggattaaag
tgtgaagactgcggcatgaatgtgcaccacaaatgccgggagaaggtggccaacctgtgt
ggtatcaaccaaaagctcttggctgaggccttgaaccaagtgacccagaaagcttcccgg
aagccagagacaccagagactgtcggaatataccagggattcgagaagaagacagctgtc
tctgggaatgacatcccagacaacaacgggacctatggcaagatctgggaggggagcaac
cggtgccgccttgagaacttcaccttccagaaagtacttggcaaaggcagctttggcaag
gtactgcttgcagaactgaagggcaaggaaaggtactttgcaatcaagtacctgaagaag
gacgtggtgttgatcgacgatgacgtggagtgcaccatggtggagaagcgggtgctggcg
ctcgcctgggagaatcccttcctcacccatctcatctgtaccttccagaccaaggaccac
ctcttctttgtgatggagttcctcaatgggggcgatctgatgttccacattcaggacaaa
ggccgcttcgaactctaccgggctacgttttatgcagctgagatcatctgcggactgcag
tttctacatggcaaaggcatcatttacagggacctcaagctagacaatgtaatgctggac
aaggatggccacatcaagattgctgacttcgggatgtgcaaagagaatatatttggggag
aaccgggccagcacattctgcggcactcctgactacatcgcccctgagatcctgcagggc
ctgaagtactcattttccgtggactggtggtcttttggggtcctcctctatgagatgctc
attggccagtcccccttccatggtgatgatgaggacgagctctttgagtccatccgggtg
gacacaccacactacccgcgctggatcaccaaggagtccaaggacatcatggagaagctc
ttcgagagggaccctgccaagaggctgggagtaacaggaaacatcaggcttcaccccttt
ttcaagactatcaactggaacctgctggagaagcggaaggtggagccgccctttaagccc
aaagtgaaatccccttcagactacagcaactttgacccagagttcctgaatgagaaaccc
caactttccttcagtgacaagaacctcatcgactctatggaccagacagccttcaagggc
ttctcctttgtgaaccccaaatatgagcaattcctggaatag

DBGET integrated database retrieval system