KEGG   Rattus norvegicus (rat): 170538
Entry
170538            CDS       T01003                                 

Gene name
Prkcd
Definition
(RefSeq) protein kinase C delta type
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04140  Autophagy - animal
rno04270  Vascular smooth muscle contraction
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04722  Neurotrophin signaling pathway
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05020  Prion disease
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    170538 (Prkcd)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    170538 (Prkcd)
   04625 C-type lectin receptor signaling pathway
    170538 (Prkcd)
   04666 Fc gamma R-mediated phagocytosis
    170538 (Prkcd)
   04062 Chemokine signaling pathway
    170538 (Prkcd)
  09152 Endocrine system
   04912 GnRH signaling pathway
    170538 (Prkcd)
   04915 Estrogen signaling pathway
    170538 (Prkcd)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    170538 (Prkcd)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    170538 (Prkcd)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    170538 (Prkcd)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    170538 (Prkcd)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    170538 (Prkcd)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    170538 (Prkcd)
   04931 Insulin resistance
    170538 (Prkcd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    170538 (Prkcd)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    170538 (Prkcd)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     170538 (Prkcd)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   170538 (Prkcd)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C C1_2 zf-RING-like Zf_RING zf-RING_9 DZR Kinase-like ABC1 Pkinase_fungal PHD FtrD-like APH CxC3 FYVE_2
Other DBs
NCBI-GeneID: 170538
NCBI-ProteinID: NP_579841
RGD: 67383
Ensembl: ENSRNOG00000016346
UniProt: P09215
Structure
PDB: 
1BDY

Position
16
AA seq 673 aa
MAPFLRISFNSYELGSLQAEDDASQPFCAVKMKEALTTDRGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEDPMSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQY
FLEDGDCKQSMRSEEEAMFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMS
PTFCDHCGTLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQKASR
KPETPETVGIYQGFEKKTAVSGNDIPDNNGTYGKIWEGSNRCRLENFTFQKVLGKGSFGK
VLLAELKGKERYFAIKYLKKDVVLIDDDVECTMVEKRVLALAWENPFLTHLICTFQTKDH
LFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHGKGIIYRDLKLDNVMLD
KDGHIKIADFGMCKENIFGENRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEML
IGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPAKRLGVTGNIRLHPF
FKTINWNLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQTAFKG
FSFVNPKYEQFLE
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggcaccgttcctgcgcatctccttcaattcctatgagctgggctccctgcaggcggag
gacgacgcaagccagcctttctgtgccgtgaagatgaaggaggcactcaccacagaccga
gggaagactctggtacagaagaagcccaccatgtaccctgagtggaagtcaacattcgac
gcccacatctatgaaggccgtgtcatccagatcgtgctgatgcgggcagctgaagacccc
atgtcggaggtgaccgtgggcgtgtcagtgctggctgagcgctgcaagaagaacaacggc
aaggctgagttctggctggacctgcagcctcaggccaaggtgctgatgtgtgtgcagtat
ttcctggaggatggggattgcaaacagtccatgcgtagtgaggaggaggccatgttccca
actatgaaccgccgtggagccattaaacaggccaagattcactacatcaagaaccacgag
ttcatcgccaccttctttgggcagcccaccttctgttctgtgtgcaaagagtttgtctgg
ggcctcaacaagcaaggctacaaatgcaggcaatgcaacgctgccatccataagaaatgc
atcgacaagattatcggccgctgcactggcactgctaccaatagccgggacaccatcttc
cagaaagaacgcttcaacatcgacatgcctcaccgattcaaggtctataactacatgagc
cccaccttctgtgaccactgtggcactttgctctggggattggtgaaacagggattaaag
tgtgaagactgcggcatgaatgtgcaccacaaatgccgggagaaggtggccaacctgtgt
ggtatcaaccaaaagctcttggctgaggccttgaaccaagtgacccagaaagcttcccgg
aagccagagacaccagagactgtcggaatataccagggattcgagaagaagacagctgtc
tctgggaatgacatcccagacaacaacgggacctatggcaagatctgggaggggagcaac
cggtgccgccttgagaacttcaccttccagaaagtacttggcaaaggcagctttggcaag
gtactgcttgcagaactgaagggcaaggaaaggtactttgcaatcaagtacctgaagaag
gacgtggtgttgatcgacgatgacgtggagtgcaccatggtggagaagcgggtgctggcg
ctcgcctgggagaatcccttcctcacccatctcatctgtaccttccagaccaaggaccac
ctcttctttgtgatggagttcctcaatgggggcgatctgatgttccacattcaggacaaa
ggccgcttcgaactctaccgggctacgttttatgcagctgagatcatctgcggactgcag
tttctacatggcaaaggcatcatttacagggacctcaagctagacaatgtaatgctggac
aaggatggccacatcaagattgctgacttcgggatgtgcaaagagaatatatttggggag
aaccgggccagcacattctgcggcactcctgactacatcgcccctgagatcctgcagggc
ctgaagtactcattttccgtggactggtggtcttttggggtcctcctctatgagatgctc
attggccagtcccccttccatggtgatgatgaggacgagctctttgagtccatccgggtg
gacacaccacactacccgcgctggatcaccaaggagtccaaggacatcatggagaagctc
ttcgagagggaccctgccaagaggctgggagtaacaggaaacatcaggcttcaccccttt
ttcaagactatcaactggaacctgctggagaagcggaaggtggagccgccctttaagccc
aaagtgaaatccccttcagactacagcaactttgacccagagttcctgaatgagaaaccc
caactttccttcagtgacaagaacctcatcgactctatggaccagacagccttcaagggc
ttctcctttgtgaaccccaaatatgagcaattcctggaatag

KEGG   Rattus norvegicus (rat): 24680
Entry
24680             CDS       T01003                                 

Gene name
Prkca
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04066  HIF-1 signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04613  Neutrophil extracellular trap formation
rno04650  Natural killer cell mediated cytotoxicity
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno04960  Aldosterone-regulated sodium reabsorption
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05032  Morphine addiction
rno05143  African trypanosomiasis
rno05146  Amoebiasis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05223  Non-small cell lung cancer
rno05225  Hepatocellular carcinoma
rno05231  Choline metabolism in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24680 (Prkca)
   04012 ErbB signaling pathway
    24680 (Prkca)
   04014 Ras signaling pathway
    24680 (Prkca)
   04015 Rap1 signaling pathway
    24680 (Prkca)
   04310 Wnt signaling pathway
    24680 (Prkca)
   04370 VEGF signaling pathway
    24680 (Prkca)
   04066 HIF-1 signaling pathway
    24680 (Prkca)
   04020 Calcium signaling pathway
    24680 (Prkca)
   04070 Phosphatidylinositol signaling system
    24680 (Prkca)
   04072 Phospholipase D signaling pathway
    24680 (Prkca)
   04071 Sphingolipid signaling pathway
    24680 (Prkca)
   04151 PI3K-Akt signaling pathway
    24680 (Prkca)
   04150 mTOR signaling pathway
    24680 (Prkca)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24680 (Prkca)
   04540 Gap junction
    24680 (Prkca)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    24680 (Prkca)
   04650 Natural killer cell mediated cytotoxicity
    24680 (Prkca)
   04664 Fc epsilon RI signaling pathway
    24680 (Prkca)
   04666 Fc gamma R-mediated phagocytosis
    24680 (Prkca)
   04670 Leukocyte transendothelial migration
    24680 (Prkca)
  09152 Endocrine system
   04911 Insulin secretion
    24680 (Prkca)
   04929 GnRH secretion
    24680 (Prkca)
   04912 GnRH signaling pathway
    24680 (Prkca)
   04921 Oxytocin signaling pathway
    24680 (Prkca)
   04926 Relaxin signaling pathway
    24680 (Prkca)
   04935 Growth hormone synthesis, secretion and action
    24680 (Prkca)
   04918 Thyroid hormone synthesis
    24680 (Prkca)
   04919 Thyroid hormone signaling pathway
    24680 (Prkca)
   04928 Parathyroid hormone synthesis, secretion and action
    24680 (Prkca)
   04916 Melanogenesis
    24680 (Prkca)
   04925 Aldosterone synthesis and secretion
    24680 (Prkca)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24680 (Prkca)
   04270 Vascular smooth muscle contraction
    24680 (Prkca)
  09154 Digestive system
   04970 Salivary secretion
    24680 (Prkca)
   04971 Gastric acid secretion
    24680 (Prkca)
   04972 Pancreatic secretion
    24680 (Prkca)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24680 (Prkca)
   04961 Endocrine and other factor-regulated calcium reabsorption
    24680 (Prkca)
  09156 Nervous system
   04724 Glutamatergic synapse
    24680 (Prkca)
   04727 GABAergic synapse
    24680 (Prkca)
   04725 Cholinergic synapse
    24680 (Prkca)
   04728 Dopaminergic synapse
    24680 (Prkca)
   04726 Serotonergic synapse
    24680 (Prkca)
   04720 Long-term potentiation
    24680 (Prkca)
   04730 Long-term depression
    24680 (Prkca)
   04723 Retrograde endocannabinoid signaling
    24680 (Prkca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24680 (Prkca)
  09158 Development and regeneration
   04360 Axon guidance
    24680 (Prkca)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24680 (Prkca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24680 (Prkca)
   05206 MicroRNAs in cancer
    24680 (Prkca)
   05205 Proteoglycans in cancer
    24680 (Prkca)
   05231 Choline metabolism in cancer
    24680 (Prkca)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24680 (Prkca)
   05214 Glioma
    24680 (Prkca)
   05223 Non-small cell lung cancer
    24680 (Prkca)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    24680 (Prkca)
   05161 Hepatitis B
    24680 (Prkca)
   05171 Coronavirus disease - COVID-19
    24680 (Prkca)
   05164 Influenza A
    24680 (Prkca)
   05163 Human cytomegalovirus infection
    24680 (Prkca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    24680 (Prkca)
   05143 African trypanosomiasis
    24680 (Prkca)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    24680 (Prkca)
   05022 Pathways of neurodegeneration - multiple diseases
    24680 (Prkca)
  09165 Substance dependence
   05031 Amphetamine addiction
    24680 (Prkca)
   05032 Morphine addiction
    24680 (Prkca)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24680 (Prkca)
   05415 Diabetic cardiomyopathy
    24680 (Prkca)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    24680 (Prkca)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24680 (Prkca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24680 (Prkca)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24680 (Prkca)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     24680 (Prkca)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   24680 (Prkca)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    24680 (Prkca)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 ABC1 APH
Other DBs
NCBI-GeneID: 24680
NCBI-ProteinID: NP_001099183
RGD: 3395
Ensembl: ENSRNOG00000003491
Structure
PDB: 

Position
10
AA seq 636 aa
MADVYPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQLMTKH
PAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPV
LTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggctgacgtttacccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcatgaggtgaaagaccacaaattcatc
gcccgcttcttcaagcaacccaccttctgcagccactgcaccgacttcatctgggggttt
ggaaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgag
tttgttactttctcttgtccgggtgcggataagggacctgacactgatgaccccagaagc
aagcacaagttcaaaatccacacctatggaagccctaccttctgtgatcactgtgggtcc
ctgctctacggacttatccaccaagggatgaaatgcgacacctgcgacatgaatgttcac
aagcagtgcgtgatcaatgtccccagcctctgcggaatggatcacacagagaagaggggg
cggatttacctgaaggcagaggtcacagatgaaaagctgcacgtcaccgtacgagatgca
aaaaatctaatccctatggatccaaatgggctttcggatccttacgtgaagctgaaactt
attcctgaccccaagaatgagagcaaacagaaaaccaaaaccatccgatccacactgaac
cctcagtggaatgagtccttcacgttcaaattaaaaccttcagacaaagaccggcgactg
tccgtagaaatctgggactgggatcggacgacacggaatgacttcatgggctccctttcc
ttcggcgtctcagagctgatgaagatgccagccagtggatggtacaagttgctcaaccaa
gaggagggtgaatactacaatgtgcccattccagaaggagatgaagaaggcaacgtggaa
ctcaggcagaagttcgagaaagccaagctgggccccgctggaaacaaagtcatcagccct
tcagaagacaggaagcagccatctaacaacctggacagggtgaaactcacagacttcaac
ttcctcatggtgctggggaaggggagttttggaaaggtgatgcttgctgacaggaaggga
acagaggaactgtacgccatcaaaatcctgaagaaggacgtggtgatccaggatgacgac
gtggagtgcaccatggtggagaagcgggttctggccctgctcgacaagcccccgttcctg
acacagctgcactcctgcttccagacagtggaccggctgtacttcgtcatggaatacgtc
aacggtggggacctcatgtaccacattcagcaagtcggaaaatttaaggagccacaagca
gtattctatgcagccgagatctccatcggactgttctttcttcacaaaagaggaatcatt
tacagggatctgaagctggacaacgtcatgctggactcagaagggcatatcaaaatcgcc
gacttcgggatgtgcaaggaacacatgatggacggggtcacgaccaggaccttctgtggg
actccggattacattgccccagagataatcgcttaccagccatatggaaagtctgtggac
tggtgggcgtacggcgtgctcctgtatgagatgctagctgggcagcttatgaccaaacac
cctgccaagcggctgggctgcgggcccgagggggaaagggatgtcagagagcatgccttc
tttaggaggatcgactgggagaagttggagaacagggagatccaaccgccattcaagccc
aaagtgtgcggcaaaggagcagaaaactttgacaagttcttcacacgagggcagcctgtc
ttaacaccaccagatcagctggtcatcgctaacatagaccagtctgattttgaagggttc
tcgtatgtcaacccccagtttgtgcacccaatcttgcaaagtgcagtatga

KEGG   Rattus norvegicus (rat): 25023
Entry
25023             CDS       T01003                                 

Gene name
Prkcb
Definition
(RefSeq) protein kinase C beta type isoform 2
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04066  HIF-1 signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04150  mTOR signaling pathway
rno04270  Vascular smooth muscle contraction
rno04310  Wnt signaling pathway
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04613  Neutrophil extracellular trap formation
rno04650  Natural killer cell mediated cytotoxicity
rno04662  B cell receptor signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno04931  Insulin resistance
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno04960  Aldosterone-regulated sodium reabsorption
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05032  Morphine addiction
rno05140  Leishmaniasis
rno05143  African trypanosomiasis
rno05146  Amoebiasis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05223  Non-small cell lung cancer
rno05225  Hepatocellular carcinoma
rno05231  Choline metabolism in cancer
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25023 (Prkcb)
   04012 ErbB signaling pathway
    25023 (Prkcb)
   04014 Ras signaling pathway
    25023 (Prkcb)
   04015 Rap1 signaling pathway
    25023 (Prkcb)
   04310 Wnt signaling pathway
    25023 (Prkcb)
   04370 VEGF signaling pathway
    25023 (Prkcb)
   04064 NF-kappa B signaling pathway
    25023 (Prkcb)
   04066 HIF-1 signaling pathway
    25023 (Prkcb)
   04020 Calcium signaling pathway
    25023 (Prkcb)
   04070 Phosphatidylinositol signaling system
    25023 (Prkcb)
   04071 Sphingolipid signaling pathway
    25023 (Prkcb)
   04150 mTOR signaling pathway
    25023 (Prkcb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25023 (Prkcb)
   04540 Gap junction
    25023 (Prkcb)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    25023 (Prkcb)
   04650 Natural killer cell mediated cytotoxicity
    25023 (Prkcb)
   04662 B cell receptor signaling pathway
    25023 (Prkcb)
   04666 Fc gamma R-mediated phagocytosis
    25023 (Prkcb)
   04670 Leukocyte transendothelial migration
    25023 (Prkcb)
   04062 Chemokine signaling pathway
    25023 (Prkcb)
  09152 Endocrine system
   04911 Insulin secretion
    25023 (Prkcb)
   04929 GnRH secretion
    25023 (Prkcb)
   04912 GnRH signaling pathway
    25023 (Prkcb)
   04921 Oxytocin signaling pathway
    25023 (Prkcb)
   04935 Growth hormone synthesis, secretion and action
    25023 (Prkcb)
   04918 Thyroid hormone synthesis
    25023 (Prkcb)
   04919 Thyroid hormone signaling pathway
    25023 (Prkcb)
   04928 Parathyroid hormone synthesis, secretion and action
    25023 (Prkcb)
   04916 Melanogenesis
    25023 (Prkcb)
   04925 Aldosterone synthesis and secretion
    25023 (Prkcb)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25023 (Prkcb)
  09154 Digestive system
   04970 Salivary secretion
    25023 (Prkcb)
   04971 Gastric acid secretion
    25023 (Prkcb)
   04972 Pancreatic secretion
    25023 (Prkcb)
   04973 Carbohydrate digestion and absorption
    25023 (Prkcb)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    25023 (Prkcb)
   04961 Endocrine and other factor-regulated calcium reabsorption
    25023 (Prkcb)
  09156 Nervous system
   04724 Glutamatergic synapse
    25023 (Prkcb)
   04727 GABAergic synapse
    25023 (Prkcb)
   04725 Cholinergic synapse
    25023 (Prkcb)
   04728 Dopaminergic synapse
    25023 (Prkcb)
   04726 Serotonergic synapse
    25023 (Prkcb)
   04720 Long-term potentiation
    25023 (Prkcb)
   04730 Long-term depression
    25023 (Prkcb)
   04723 Retrograde endocannabinoid signaling
    25023 (Prkcb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    25023 (Prkcb)
  09159 Environmental adaptation
   04713 Circadian entrainment
    25023 (Prkcb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25023 (Prkcb)
   05206 MicroRNAs in cancer
    25023 (Prkcb)
   05205 Proteoglycans in cancer
    25023 (Prkcb)
   05231 Choline metabolism in cancer
    25023 (Prkcb)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    25023 (Prkcb)
   05214 Glioma
    25023 (Prkcb)
   05223 Non-small cell lung cancer
    25023 (Prkcb)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    25023 (Prkcb)
   05161 Hepatitis B
    25023 (Prkcb)
   05171 Coronavirus disease - COVID-19
    25023 (Prkcb)
   05164 Influenza A
    25023 (Prkcb)
   05163 Human cytomegalovirus infection
    25023 (Prkcb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    25023 (Prkcb)
   05140 Leishmaniasis
    25023 (Prkcb)
   05143 African trypanosomiasis
    25023 (Prkcb)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    25023 (Prkcb)
   05022 Pathways of neurodegeneration - multiple diseases
    25023 (Prkcb)
  09165 Substance dependence
   05031 Amphetamine addiction
    25023 (Prkcb)
   05032 Morphine addiction
    25023 (Prkcb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    25023 (Prkcb)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    25023 (Prkcb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    25023 (Prkcb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25023 (Prkcb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25023 (Prkcb)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     25023 (Prkcb)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   25023 (Prkcb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C Kinase-like CEP76-C2 ABC1 APH
Other DBs
NCBI-GeneID: 25023
NCBI-ProteinID: NP_001165776
RGD: 3396
Ensembl: ENSRNOG00000012061
UniProt: P68403
Structure
PDB: 
1A25 3PFQ

Position
1
AA seq 671 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGL
GLQGFQSQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF
SYTNPEFVINV
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcacggtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatttggggctta
ggtttgcagggattccagagtcaggtctgctgctttgttgtacacaagcgctgccatgaa
ttcgtcacgttctcctgccctggtgcagacaagggcccggcctctgatgacccacggagc
aaacacaagtttaagatccacacctactccagccctaccttctgtgaccactgtggatca
ctgctgtatgggctcatccaccaggggatgaaatgcgacacctgtatgatgaatgtccac
aagcgctgcgtgatgaacgtccccagcctctgtggcaccgaccacacagaacgccgtggc
cgcatctacatccaggcccacatcgacagggaggtcctcatcgttgttgtaagagatgct
aaaaatctggtacctatggaccccaacggcttgtcagatccctacgtaaaactgaaactg
atccctgatcccaaaagtgagagcaagcagaagaccaagactatcaaatgctccctcaac
ccggagtggaacgaaaccttcagatttcagctgaaggaatcagacaaagacagaagactg
tccgtagagatctgggattgggacctgaccagcaggaatgacttcatgggatctctgtcg
tttgggatttcagaactacagaaagccggagtggatggctggttcaagttactaagccag
gaagaaggcgagtactttaatgtgccggtgccgccggaaggaagcgagggcaatgaagag
ctgcggcagaagtttgagagagccaagattggccaaggtaccaaggctccagaagaaaag
acagcgaacactatatccaaatttgacaacaatggcaacagggaccggatgaaactgacc
gattttaacttcctgatggtgctggggaaaggcagctttggcaaggtcatgctctcagag
cggaagggtacagatgaactctatgccgtgaagatcctgaagaaagatgtggtgatccaa
gatgacgatgtggagtgcacaatggtggagaagagggtgctggccctgcctgggaagccc
ccattcctgactcagctccattcctgcttccagaccatggaccgcctctactttgtgatg
gagtatgtgaacgggggcgacctcatgtaccacatccaacaagttggccgtttcaaggag
ccccatgctgtattttacgctgcagagattgccatcggtcttttcttcttgcagagcaag
ggcatcatttaccgtgacctgaaacttgacaacgtgatgctggattccgaggggcacatc
aaaatcgctgactttggcatgtgtaaagagaatatctgggatggggtgacaaccaagaca
ttctgtggcactccagactacattgccccagagatcattgcttatcagccctacgggaag
tctgtggactggtgggcgtttggagtcctgctgtatgaaatgttggctggccaggcacct
tttgaaggggaggatgaggatgaactcttccagtcaatcatggagcacaacgtggcgtat
cccaagtccatgtctaaggaagctgtggcaatctgcaaagggctaatgaccaaacaccca
ggcaagcgcctgggttgtgggcctgaaggggaacgagacattaaggagcatgcatttttc
cggtatatcgactgggagaaactcgaacgcaaggagattcagccaccttataaaccaaaa
gctagagacaagcgagacacctccaacttcgacaaagagttcaccaggcagcctgtggaa
ctgactcccactgacaaactcttcatcatgaacttggaccaaaatgaatttgctggcttc
tcgtatactaacccagagtttgtcattaatgtgtag

DBGET integrated database retrieval system