KEGG   Rattus norvegicus (rat): 170551
Entry
170551            CDS       T01003                                 

Gene name
Slc5a6, SMVT
Definition
(RefSeq) solute carrier family 5 member 6
  KO
K14386  solute carrier family 5 (sodium-dependent multivitamin transporter), member 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04977  Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    170551 (Slc5a6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    170551 (Slc5a6)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   170551 (Slc5a6)
SSDB
Motif
Pfam: SSF
Other DBs
NCBI-GeneID: 170551
NCBI-ProteinID: NP_570102
RGD: 69648
Ensembl: ENSRNOG00000057628
UniProt: O70247 B4F760
Position
6q14
AA seq 634 aa
MTVASTAAPSYTTSDTNRVISTFSVVDYVVFGLLLVLSLVIGLYHACRGWGRHTVGELLM
ADRKMGCLPVALSLLATFQSAVAILGGPAEIYRFGTQYWFLGCSYFLGLLIPAHIFIPVF
YRLHLTSAYEYLELRFNKAVRICGTVTFIFQMVVYMGVALYAPSLALNAVTGFDLWLSVL
ALGIVCNIYTALGGLKAVIWTDVFQTLIMFLGQLVVIIVGAAKVGGLGHVWAVASQHGLI
SGIELDPDPFVRHTFWTLAFGGVFMMLSLYGVNQAQVQRYLSSHSEKAAVLSCYAVFPCQ
QVALCMSCLIGLVMFAYYKKYSMSPQQEQAAPDQLVLYFVMDLLKDMPGLPGLFVACLFS
GSLSTISSAFNSLATVTMEDLIQPWFPQLTETRAIMLSRSLAFAYGLVCLGMAYVSSHLG
SVLQAALSIFGMVGGPLLGLFCLGMFFPCANPLGAIVGLLTGLTMAFWIGIGSIVSRMSS
AAASPPLNGSSSFLPSNLTVATVTTLMPSTLSKPTGLQQFYSLSYLWYSAHNSTTVIAVG
LIVSLLTGGMRGRSLNPGTIYPVLPKLLALLPLSCQKRLCWRSHNQDIPVVTNLFPEKMG
NGALQDSRDKERMAEDGLVHQPCSPTYIVQETSL
NT seq 1905 nt   +upstreamnt  +downstreamnt
atgactgtggcgagcactgcggctccctcctatacaacctcagacaccaaccgggttatt
tccaccttttctgttgtggactatgtggtgtttggcctgttgctggttctctcccttgtc
attgggctctatcatgcttgccgaggctggggccgccatactgttggtgagctgctgatg
gcagaccgaaaaatgggctgccttcctgtggcactgtccttgctggccaccttccagtca
gccgtggcgatccttgggggaccagctgagatctaccgatttggaacccagtattggttc
ctggggtgctcctacttcctggggcttctgatccctgctcacatcttcatccctgtcttc
taccgcctgcatcttaccagcgcctatgagtacctagagctccgcttcaataaagcagtc
cggatctgtgggactgtgaccttcatctttcagatggtggtctacatgggagtggctctc
tatgcaccgtccctggccctcaatgcagtgactggatttgatctatggctgtcagtcctg
gccctaggaattgtctgcaacatctacactgcactgggtgggctgaaggctgtcatctgg
acagatgtgttccaaacgttgatcatgttcctagggcagctggtggttatcattgtagga
gcggccaaagtgggcggcttggggcatgtatgggctgtggcttcccagcatggcctcatc
tctgggattgagctggatcctgacccctttgtacgtcatactttctggactttggccttt
ggcggcgtcttcatgatgctctccttatatggagtgaatcaggctcaggtgcagcgctac
ctcagttcccactcagagaaggctgctgtgctctcctgctatgcagtgttcccttgccag
caagtggccctctgcatgagctgcctcattggtctggtcatgtttgcctattataagaaa
tatagtatgagcccccaacaagagcaagcagcccctgaccagttagtcctctattttgtg
atggacctcctgaaagacatgccagggctgcccgggctcttcgttgcttgcctcttcagt
ggatctctcagcaccatatcctccgcattcaattcactggccactgtcacaatggaagac
ctgatccagccctggttccctcagttgactgaaacccgggccatcatgctctctcgaagc
cttgcctttgcctatgggctagtttgcctgggaatggcctatgtttcctctcatctggga
tcagtgctccaggcagcactcagcatctttggcatggttggagggccactgctgggactc
ttctgccttgggatgttctttccgtgtgccaaccctcttggtgccattgtaggcctgttg
acgggactcaccatggccttctggattggcattgggagcatagtaagcaggatgagttct
gctgcagcatcccctccccttaatggatccagctccttcctgcccagcaatctaactgtc
gccactgtgaccaccctgatgccttctaccctgtccaagcccacaggactgcagcagttc
tattccctgtcctatttatggtacagtgcgcacaactccaccacagtcattgcagtgggc
ctgattgtcagtctgctcactgggggaatgcggggccggtccctgaaccctggcaccatt
taccctgtgttgccaaagctccttgcactcctgcccttatcctgccagaagcggctttgc
tggagaagccacaaccaggatatccctgtggtcaccaacctgtttccagagaagatgggg
aacggagcgctgcaggacagcagagacaaagagaggatggctgaagatggccttgtccat
cagccatgcagccccacctacattgtccaagagacgtccctgtga

DBGET integrated database retrieval system