KEGG   Rattus norvegicus (rat): 170566Help
Entry
170566            CDS       T01003                                 

Gene name
Slc16a10, Tat1
Definition
(RefSeq) solute carrier family 16 member 10
  KO
K08187  MFS transporter, MCT family, solute carrier family 16 (monocarboxylic acid transporters), member 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04919  Thyroid hormone signaling pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    170566 (Slc16a10)
  09154 Digestive system
   04974 Protein digestion and absorption
    170566 (Slc16a10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    170566 (Slc16a10)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC16: Monocarboxylate transporter
   170566 (Slc16a10)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Monocarboxylate transporter (MCT) family [TC:2.A.1.13]
    170566 (Slc16a10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 MFS_4
Motif
Other DBs
NCBI-GeneID: 170566
NCBI-ProteinID: NP_620186
RGD: 69197
Ensembl: ENSRNOG00000000588
UniProt: Q91Y77
Position
20q12
AA seq 514 aa AA seqDB search
MVPSLEEPAAAERETNEAQPPGPAPSDDAPLPVPGPSDVSDGSVEKVEVELTRSTGNQEP
PEPPEGGWGWLVMLAAMWCNGSVFGIQNAYGVLFVSMLETFGAKDDDNMAFKAAWVGSLS
MGMIFFCCPIVSVFTDMFGCRRTAVLGAAVGFVGLMSSSFVSSIEPLYFTYGVVFACGCS
FAYQPSLVILGHYFKKRLGLVNGIVTAGSSVFTILLPLLLGNLTSTVGLCYTLRILCIFM
FVLFLAGFTYRPLVPSSKEKESEDSRSSFFSRRKLSPPKKIFNFALFKETAYAVWAAGIP
LALFGYFVPYVHLMNHVKERFKDVNNKEVLFMCIGVTSGVGRLLFGRIADYLPGVKKVYL
QVLSFFFIGLTSMMIPLCSVFGALIALCLIMGLFDGCFISIMAPIAFELVGPQDASQAIG
FLLGFMSIPMTVGPPVAGLLHDKLGSYDLAFYLAGIPPFIGGAVLCLIPWIHSKKQREIS
KNTGGEKMEKMLANQSSLLSSSSGIFKKESDSII
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggtgccgtccctggaggagcccgccgccgccgagcgggagacgaacgaggcgcagccg
ccggggcccgcgccctcggatgacgctccgctgcccgtcccgggaccgtcggatgtctcc
gacgggtccgtagagaaagtggaggtggagctgacgaggtcaacgggcaaccaggagccc
cccgagccccccgagggcggctggggctggctggtgatgctggcggccatgtggtgcaat
gggtctgtgtttggcatccagaacgcctacggggtgctcttcgtgtccatgctggagacc
ttcggggccaaggacgatgacaacatggccttcaaggcagcatgggtaggctcgctgtcc
atgggcatgatcttcttctgctgccccatagtgagtgtcttcacagacatgtttggttgc
cggagaacagctgtcctgggtgcagctgtaggattcgttggactcatgtccagttctttt
gtaagctccatcgagcccctctacttcacctatggagtcgtatttgcctgcggctgctcc
tttgcctaccagccgtcactggtcattctgggacactacttcaagaagcgcctgggacta
gtcaacggcatcgtcacggctggcagcagcgtcttcacaatcttgctccctttgctgtta
gggaatctgacctccaccgtgggcctctgctacacactgcgaattctctgcatcttcatg
ttcgttctctttctggctggcttcacttaccgacctctcgttcccagcagcaaagagaaa
gagagtgaggacagcagaagttccttcttctccaggagaaagcttagtcctccaaaaaaa
atcttcaactttgccctcttcaaggagaccgcctatgccgtgtgggctgctgggatacca
cttgctctctttggatactttgtgccttatgttcacttgatgaaccatgtaaaggaaagg
tttaaagatgtgaacaacaaggaggtgctcttcatgtgcattggcgtcacttcaggggtt
ggacggcttctcttcggccgcattgcagactatttgcctggtgtgaaaaaggtctacctg
caggtcctctccttcttcttcatcggcctgacgtccatgatgattcccctgtgcagcgtt
ttcggagccctcattgccctctgcctcatcatgggtctcttcgacgggtgcttcatctcc
atcatggcgcccattgcctttgaattagttggtcctcaggatgcttcccaggccattggg
tttctccttggattcatgtccatccccatgactgttggtcctcctgttgcagggttgctc
catgacaaactgggctcctatgatttggccttctacctcgctgggatccctcccttcatt
ggaggtgctgtgctctgcttaatcccgtggattcatagcaagaagcagagagagatcagt
aaaaacaccggaggggagaagatggagaaaatgctggcgaaccagagctctctcctgtca
agttcatctggaatcttcaaaaaggaatccgactcaattatttaa

DBGET integrated database retrieval system