KEGG   Rattus norvegicus (rat): 170568
Entry
170568            CDS       T01003                                 

Gene name
Dmbt1, Crpd
Definition
(RefSeq) deleted in malignant brain tumors 1
  KO
K13912  deleted in malignant brain tumors 1 protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    170568 (Dmbt1)
SSDB
Motif
Pfam: SRCR CUB Zona_pellucida SRCR_2 CUB_2
Other DBs
NCBI-GeneID: 170568
NCBI-ProteinID: NP_074040
RGD: 61984
UniProt: Q8CIZ5
Position
1q41
AA seq 1418 aa
MGISIVIFEICLLWGQILSTASQSRSSTPDWWNHGGTINDVIYDTQETPEVTTTQVPDST
SIGTDSGLAVRLVNGGDRCRGRVEILYQGSWGTMCDDGTDSGLAVRLVNGGDRCRGRVEI
LYQGSWGTMCDDSWDINDANVVCRQLGCGWALSAPGSAQFGQGLGPIVLDDVACRGHEAY
LWSCSHRGWLSHNCGHQEDAGVICSDSQTSSPTPGWWNPGGTNNDVIYDTQETTETSQTS
SPTPDWWNHGGTINDVIYDTQETTEGTDSGLAVRLVNGGDRCRGRVEILYQGSWGTVCDD
SWDINDANVVCRQLGCGWALSAPGSAQFGQGSGSIVLDDVACRGHEAYLWSCSHRGWLSH
NCGHQEDAGVICSYSQTSSPTPDSQTSSPTPGWWNPGGTNNDVSYGPEQTTDATDSGLAV
RLVNGGDRCQGRVEILYQGSWGTVCDDSWDTKDANVVCRQLVCGWALSAPGSAHFGQGSG
SIVLDDVACTGHEAYLWSCSHRGWLSHNCGHHEDAGVICSDAQTQSTTWPDMWPTTTPET
TTDWWTTKYSSSVPTTQFPTIADWWTTPSPEYTCGGLLTLPYGQFSSPYYPGSYPNNARC
LWKIFVSSMNRVTVVFTDVQLEGGCNYDYILVFDGPENNSSLIARVCDGFNGSFTSTQNF
MSVVFITDGSVTRRGFQADYYSTPISTSTTSPTTFPIVTDWWTTPSPEYTCGGLLTLPYG
QFSSPYYPGSYPNNARCLWKIFVPSMNRVTVVFTDVQLEGGCNYDYILGFDGPEYNSSLI
ARVCDGSNGSFTSTQNFMSVVFITDGSVTRRGFQADYYSTPIRTSTTPPTTFPIITGNDS
SLVLRLVNGTNRCEGRVEILYRGSWVPCADDSWDINDANVVCRQLGCGSALSAPGNAWFG
QGSGLIVLDDVSCSGYESHLWNCRHPGWLVHNCRHVEDAGVICSLPDPTPSPGPVWTSPP
FVNYTCGGFLTGLSGQFSSPYYPGSYPNNARCLWNIEVPNNYRVTVVFRDVQLEGGCNYD
YIEIFDGPHHSSPLIARVCDGAMGSFTSTSNFMSVRFTTDHSVTRRGFRADYYSDFDNNT
TNLLCLSNHMRASVSRSYLQSMGYSSRDLVIPGWNVSYQCQPQITQREVIFTIPYTGCGT
TKQADNETINYSNFLKAAVSNGIIKRRKDLHIHVSCKMLQNTWVNTMYITNNTVEIQEVQ
YGNFDVNISFYTSSSFLYPVTSSPYYVDLDQNLYLQAEVLHSDTSLALFVDTCVASPHPN
DFSSLTYDLIRSGCIRDETYQSYSSPSPRITRFKFSSFHFLNRFPSVYLQCKLVVCRAND
VSSRCYRGCVVRSKRDVGSYQEKVDVVLGPIQLQSPSKEKRSLDLAVADVEKPASSQEVY
PTAAIFGGVFLALVVAVAAFTLGRKTRTARGQPPSTKM
NT seq 4257 nt   +upstreamnt  +downstreamnt
atggggatctccatcgttatctttgaaatatgtcttttgtggggtcaaattctttctaca
gcttctcaatcaagaagttccacacctgattggtggaaccatgggggcacaattaatgat
gtgatctacgacactcaagaaaccccagaagtgacgactactcaagttcctgattccaca
tcaataggaacagattctggtttggctgtgaggctggtgaatggaggagacaggtgtcgg
ggtcgcgtggagatcctttaccagggttcctggggcaccatgtgtgatgacggaacagat
tctggtttggctgtgaggctggtgaatggaggagacaggtgtcggggtcgcgtggagatc
ctttaccagggttcctggggcaccatgtgtgatgacagctgggacatcaatgatgccaac
gtggtgtgcaggcagctgggctgtggctgggccttgtctgccccaggaagtgcccagttt
ggacagggtctgggtcccattgttctggatgacgtggcctgtagaggacatgaggcctat
ctgtggagctgctcccaccgaggctggctctctcataactgtggacatcaggaggatgct
ggagtgatctgctcagattctcaaacaagcagtcccacacccggttggtggaaccccggg
ggcacaaataacgatgtgatctacgacactcaagaaaccacagaaacttctcaaacaagc
agtcccacacctgattggtggaaccatgggggcacaattaatgatgtgatctatgacact
caagaaaccacagaaggaacagattctggtttggctgtgaggctggtgaatggaggagac
aggtgtcggggtcgtgtggagatcctttaccagggttcctggggcaccgtgtgtgacgac
agctgggacatcaatgatgccaacgtggtgtgcaggcagctgggctgtggctgggccttg
tctgccccaggaagtgcccagtttggacagggctctgggtccattgttctggatgacgtg
gcctgtagaggacatgaggcctatctgtggagctgctcccaccgaggctggctctctcat
aactgtggacatcaggaggatgctggagtcatctgttcatattctcaaacaagcagtccc
acacccgattctcaaacaagcagtcccacacccggttggtggaaccccgggggcacaaat
aacgatgtgtcctatggacccgaacagaccacagacgcaacagattctggtttggctgtg
aggctggtgaatggaggagacaggtgtcagggtcgtgtggagatcctttaccagggttcc
tggggtaccgtgtgtgacgacagctgggacaccaaggatgccaacgtggtgtgcaggcag
ctggtctgtggctgggccttgtctgccccaggaagtgcccactttggacaaggctctgga
tccattgttctggatgacgtggcctgtacaggacatgaggcctatctgtggagctgctcc
caccgaggctggctctctcataactgtggccaccatgaggatgctggagtcatctgttca
gatgcccaaacccagagcacaacctggccagatatgtggcctactaccactccagaaact
acaacagattggtggactacaaaatattcttcctctgttcctacaacacaattccccacc
atagccgattggtggacaactccttctccggaatacacctgtggaggtttactgacccta
ccctatgggcagttttccagcccatactaccctggaagctatcctaacaatgccagatgt
ttgtggaaaattttcgtctccagcatgaaccgtgtgacagtggtcttcacagatgtgcag
cttgaaggaggttgcaactatgactacatcctggtttttgatggccctgaaaacaattct
tctctcattgctcgggtttgtgatgggttcaatggatctttcacctcaacccagaacttc
atgtctgtagtctttatcacggatggcagtgtcacgaggagagggttccaagctgactac
tactccactcctatcagcaccagcacaacctctccaacgacgttcccgatcgttactgat
tggtggacaactccttctccggaatacacctgtggaggtttactgaccctaccctatggg
cagttttccagcccatactaccctggaagctatcctaacaatgccagatgtttgtggaaa
attttcgtccccagcatgaaccgtgtgacagtggtcttcacagatgtgcagcttgaagga
ggttgcaactatgactacatcctgggttttgatggtcctgaatacaattcttctctcatt
gctcgggtttgtgatgggtccaatggatctttcacctcaacccagaacttcatgtctgta
gtctttatcacggatggcagtgtcacgaggagagggttccaagctgactactactccact
cctatcaggaccagcacaactcctccaacgacgttcccgatcattactggaaatgattct
tcattggtgctgaggctggtaaatggaacaaaccggtgtgagggccgagtggagatcttg
tacagaggctcttgggtaccgtgtgccgacgacagctgggacatcaatgatgccaatgtg
gtctgcagacagctcggttgtggctctgctctgtctgctccaggaaatgcttggtttggt
cagggttcagggctcattgtcctggatgatgtgtcttgctctgggtatgagtcccacctg
tggaattgtcgtcaccctggctggcttgttcataattgtcgtcatgttgaggatgcagga
gtcatttgctcactccctgatccgactccctctcctggtccagtttggacaagtcctcct
tttgtaaactatacttgtggaggtttcctgactggactctctgggcaattttctagccca
tactaccctgggagctatcctaataatgccagatgtttgtggaacattgaagtcccaaac
aactaccgcgtgactgtggtcttcagagatgtgcagctggaagggggctgcaactatgac
tatatagagatttttgatggcccccaccacagttcacctctcattgcccgggtttgtgat
ggggccatgggctctttcacttcaacatccaacttcatgtcagttcgcttcaccactgat
cacagtgttactcgaagagggttccgggctgactactactcagactttgacaataatacc
accaatctcctttgtctgtcaaatcacatgagagccagtgtgagcaggagctaccttcag
tccatgggctactcctccagggatcttgtcattcctggttggaacgtgagttaccagtgt
cagcctcagataacacaaagggaggtcatattcacaattccctacacaggctgcggtact
accaaacaggctgacaacgagaccatcaactactccaacttcctcaaagcggctgtttca
aatggcatcatcaaaaggagaaaggatctccacatccatgtcagctgcaagatgcttcag
aacacctgggtcaacaccatgtacatcaccaacaacacagtcgagatccaggaagtccag
tatggcaattttgacgtgaatatttccttttatacatcctcctccttcttgtatccagtg
accagcagcccatattatgtggatctggaccagaatttgtaccttcaggccgaagtcctc
cattcggatacctctttggctctgtttgtggacacctgtgtggcttcgccacatcccaat
gacttctcgtctttgacatatgatctcatcaggagtggatgcatacgagatgaaacttac
caatcttactcctcgccctcaccacgcatcacccgctttaaattcagttctttccacttc
ctgaaccgcttcccctcagtatacctacagtgtaaactggtggtttgtcgagcaaacgat
gtctcctcacggtgctacagaggatgtgtagtaaggtccaagagggatgtaggctcctac
caagaaaaggtggatgttgttctgggacccatccagttgcaatctcccagcaaagaaaag
aggagtctcgacttggcagtggcagatgtggagaagccagccagctcccaggaggtctat
cccactgcagccatctttggtggagtcttcctggccctggttgtagctgtggcagccttc
acactgggaaggaagacacgcactgcccgtggtcaacctccaagtactaagatgtga

DBGET integrated database retrieval system