KEGG   Rattus norvegicus (rat): 170578
Entry
170578            CDS       T01003                                 

Gene name
Asz1, Gasz
Definition
(RefSeq) ankyrin repeat, SAM and basic leucine zipper domain containing 1
  KO
K18410  ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    170578 (Asz1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    170578 (Asz1)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 SAM_2 SAM_1 PgdA_N DASH_Dad4
Other DBs
NCBI-GeneID: 170578
NCBI-ProteinID: NP_570106
RGD: 621579
Ensembl: ENSRNOG00000060343
UniProt: Q8VHF9
Position
4q21
AA seq 475 aa
MAAGTLRGLAVAGGGESSDSEDDGWDIGYLDRSSQKLKRSLPVEEKNETFKKALTTGDIS
LVKELLDSGINVDSSFRYGWTPLMYAASVANVELVRFLLDRGANASFDKDKLTVLITACS
ARGSEEQVLKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNAQDE
NGYTALTWAARQGHKNVILKLLELGANKMLQTKDGRTPSEIAKRNKHLEIFNFLSLTLNP
LEGKLQQLTKEETICKLLATDSDKEKDHIFSPYTAFGDLEIFLHGLGLEHMTDLLKERDI
TLRHLLTMKKDELTKNGITSKDQQKILAALKELEVEEINFGKLPEVAKLEISGDEFLNFL
LKLNKQCGHLITAVQNIITELPVNSHKIVLEWASPRNFTSVCEELVSNVEDLNEEVCRLK
ELIQKMQNERENDPTHIPLVEEVSPWKTRILKRSAVTVCGFGLLLFICKLTFQRK
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcggcgggcacgctgaggggcttggcagtggctggtggaggcgagagcagcgatagt
gaggatgacggctgggatattgggtatctcgaccggtcctctcagaaattaaaaaggtct
ttacccgttgaagagaagaacgaaacattcaagaaagcactgaccaccggagatatttcc
ttagtgaaggaactcctggattctggcattaatgtagattccagcttccgctatggatgg
acccctcttatgtatgcagctagtgtggccaatgtagagctggttcggttccttttggac
aggggtgctaatgcaagctttgataaggacaagttaaccgttttgataactgcttgctct
gctcgtggctcagaggaacaagtcttgaagtgtgtagagttactactttcacgaaatgcg
gatcctaatgttgcttgtaggagacttatgactccaatcatgtatgctgcccgagatggt
catactcaggtcgttgctctgcttgttgctcatggagcagaagtcaacgcccaggatgag
aatggttatactgccttaacatgggcagcacggcagggtcataaaaatgtaattctgaag
ttgcttgaactcggagctaataaaatgctacagaccaaagatggcaggacaccaagtgag
attgcaaaaagaaataaacatcttgagatcttcaactttctttctctgactctaaatcca
ctggaaggaaaactccagcagctaaccaaagaagagactatttgtaaactgttggccaca
gactctgataaagaaaaagatcacatatttagtccatatacagcgtttggagatctggag
atatttttacatggccttggactggaacatatgacagacttattaaaggaaagggatata
actttaagacaccttctgaccatgaagaaagacgagcttacaaagaatggaattacaagt
aaagatcaacagaaaattttggctgctcttaaggaactagaagtagaagagataaatttt
ggaaaattacctgaagtggcaaagttggaaattagtggcgatgagttcctcaactttctt
ttgaagttaaataagcagtgtggccatttaatcacagctgtgcagaatatcattaccgag
ttacctgtgaattctcacaagatagtactggagtgggcttcacccagaaattttacttca
gtttgtgaagaactggttagtaatgttgaagatttgaatgaagaggtctgcagactgaag
gagttgattcagaagatgcagaatgaacgggaaaatgatccaactcacatcccactagta
gaagaggtgtctccatggaagactcggattttgaagaggtcagcagttacagtatgtgga
ttcgggctgctgcttttcatctgcaagctaactttccagagaaaatga

DBGET integrated database retrieval system