KEGG   Rattus norvegicus (rat): 170587
Entry
170587            CDS       T01003                                 

Gene name
Cs
Definition
(RefSeq) citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00630  Glyoxylate and dicarboxylate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01210  2-Oxocarboxylic acid metabolism
rno01230  Biosynthesis of amino acids
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    170587 (Cs)
   00630 Glyoxylate and dicarboxylate metabolism
    170587 (Cs)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     170587 (Cs)
SSDB
Motif
Pfam: Citrate_synt Queuosine_synth
Other DBs
NCBI-GeneID: 170587
NCBI-ProteinID: NP_570111
RGD: 620330
Ensembl: ENSRNOG00000023520
UniProt: Q8VHF5
Position
7q11
AA seq 466 aa
MALLTAAARLLGAKNSSCLVLAARHASASSTNLKDILSNLIPKEQARVKTFRQQHGKTVV
GQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGYSIPECQKLLPKAKGGEEPLPEGLF
WLLVTGQMPTEEQVSWLSQEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAITALNSESN
FARAYAEGINRTKYWELIYEDCMDLIAKLPCVAAKIYRNLYREGSSIGAIDSKLDWSHNF
TNMLCYTEPQFTELMRLYLTIHSDHDGGNVSAHTSHLVGSALSDTYLSFAAAMNGLAGPL
HGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYSCQ
REFALKHLPKDPMFKLVAQLYKIVPNILLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYY
TVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLMKFVDSKSG
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggctctactcactgcggcagcccggctcttgggagccaagaactcatcctgcctcgtc
cttgctgcccggcacgccagtgcttcttccacgaatttgaaagacatactgagcaatctg
atacctaaggagcaggccagagttaagaccttcagacagcagcatgggaagacagtggtt
ggccaaatcactgtggacatgatgtacggtggcatgagaggcatgaagggacttgtgtat
gagacatcggttcttgatcctgatgagggcatccgcttccgaggctatagtatccctgag
tgccagaaactgctacctaaggctaaaggtggggaagagcccctacctgagggcttattt
tggctgctggtaactggacagatgcccacagaggaacaggtctcttggctctcacaagaa
tgggcaaaaagggcagctctgccttcccatgtggtcaccatgctggacaattttccgacc
aatctgcaccccatgtctcagctcagtgcagccatcacagccctcaacagtgaaagcaac
ttcgcccgggcatatgcagagggaataaaccgaactaagtactgggagctcatctatgaa
gactgtatggacctgattgccaagctgccgtgcgttgcagcaaagatctaccggaatctg
taccgggagggcagcagtattggggcaattgactctaagctggactggtcccacaatttt
accaacatgttatgctacacagaacctcagttcacagaactcatgcgtttgtaccttacc
atccacagtgaccatgacggtggcaatgtaagtgcccacacaagccacttggtgggcagc
gccctttcagacacttacctgtcctttgcagcagctatgaatgggctggcagggcctctg
catggactagcaaaccaggaggtgcttgtctggctgacgcagctacagaaggaagtcggc
aaagacgtgtcagatgagaagttacgagactacatctggaacacactcaactcgggacgg
gttgtcccaggatatggtcatgcagtcctaaggaagactgatccacgatattcctgtcag
cgagagtttgctctgaaacatctgcccaaggatcccatgtttaagctggttgctcagctg
tacaagattgtgcccaatatcctcttagagcaaggaaaggctaagaacccctggcccaac
gtagatgctcacagtggggtgctgctccagtactatggcatgacggagatgaattactac
acagtcctgttcggagtgtcgagggcactgggtgtgttggcccagcttatctggagcaga
gccctaggctttcctctagaaaggcccaagtccatgagcacggatggtctgatgaagttt
gtggactctaagtcagggtaa

DBGET integrated database retrieval system