KEGG   Rattus norvegicus (rat): 170588Help
Entry
170588            CDS       T01003                                 

Gene name
Acot8, Pte1
Definition
(RefSeq) acyl-CoA thioesterase 8
  KO
K11992  acyl-CoA thioesterase 8 [EC:3.1.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00120  Primary bile acid biosynthesis
rno01100  Metabolic pathways
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    170588 (Acot8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    170588 (Acot8)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.27  choloyl-CoA hydrolase
     170588 (Acot8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 4HBT_3 Acyl_CoA_thio 4HBT
Motif
Other DBs
NCBI-GeneID: 170588
NCBI-ProteinID: NP_570112
RGD: 70368
Ensembl: ENSRNOG00000015187
UniProt: Q6AZ44 F7F557
Position
3q42
AA seq 374 aa AA seqDB search
MATPTQKLTSTTTNQNLRLAHGNPRDFRPLERPAGSAGCLYKFPRFSHLQQAVKMSKPED
LGDANGDADRGDLSGDLRSVLVTSVLNLEPLDEDLYRGRHYWVPTSQRLFGGQIVGQALV
AAAKSVSEDVHVHSLHCYFVRAGDPKVPVLYHVERTRTGASFSVRAVKAVQHGKAIFICQ
ASFQQMQPSPLQHQFSMPTVPPPEELLDHEALIDQYLRDPNLHEKYRVGLNRIAAREVPI
EIKLVNPPALNQLQTLEPKQMFWVRARGYIGDGDIKMHCCVAAYISDYAFLGTALLPHQS
KYKVNFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRRDGVLAVTCAQE
GVIRSKPRVSESKL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggccacacccactcagaaattgacaagcacaacgaccaatcagaatctgcgtctcgca
cacggaaaccctagggatttccggcccctggagcgacctgccggaagcgctgggtgccta
tataagtttccgcgtttctctcatctgcagcaagcagtgaaaatgtcaaagccagaggac
ctaggagatgctaatggcgacgccgaccgcggcgacctttccggggacctgcgtagtgtg
ctggtcaccagcgtgctcaacctcgagcctctagatgaagatctctacagaggaaggcat
tactgggtacctacctcccagcggctctttgggggtcagattgtgggccaggctctggtg
gctgcagccaagtccgtgagtgaagacgtccacgtgcactccctgcactgctactttgtc
cgggcaggggacccaaaggtgccagtgctgtaccatgtggagaggacacgaacaggagca
agcttctcagtgcgtgcagtgaaggctgtgcagcatggcaaggccatcttcatctgccag
gcctccttccagcagatgcagcccagccccctgcagcaccagttctccatgcccactgtg
ccccccccagaggagctgctggaccatgaggccctcattgaccagtacttaagggatcct
aaccttcatgagaaatatcgagtggggctgaaccgaattgctgcccgagaggtgcctatt
gagatcaagctggtgaacccacccgccctgaaccagctgcagacactggagcccaaacag
atgttctgggtgcgagcccggggctatattggggacggcgacatcaagatgcactgctgt
gtggctgcttacatctctgactacgccttcctggggacggcactgctgcctcaccagtcc
aagtataaagtgaacttcatggtctcgctggaccactccatgtggttccacgccccattc
cgtgctgaccactggatgctctacgagtgtgagagcccctgggctggtggctctcgaggg
ctggtacatgggcggctgtggcgtcgggatggggtccttgctgtgacctgtgcccaggag
ggtgtgatccgatcgaagcctcgggtatccgagagtaaactatag

DBGET integrated database retrieval system