KEGG   Rattus norvegicus (rat): 170635Help
Entry
170635            CDS       T01003                                 

Gene name
Dhrs9, Rdhl
Definition
(RefSeq) dehydrogenase/reductase 9
  KO
K11149  dehydrogenase/reductase SDR family member 9 [EC:1.1.-.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00830  Retinol metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    170635 (Dhrs9)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.-  Acting on the CH-OH group of donors
    1.1.-.-  
     170635 (Dhrs9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-GeneID: 170635
NCBI-ProteinID: NP_570832
RGD: 620655
Ensembl: ENSRNOG00000058568
UniProt: Q8VD48
Position
3q21
AA seq 319 aa AA seqDB search
MLLWVLALLFLCAFLWNYKGQLKIADIADKYIFITGCDSGFGNLAARTFDRKGFRVIAAC
LTESGSEALKAKTSERLHTVLLDVTNPENVKETAQWVKSHVGEKGLWGLINNAGVLGVLA
PTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKARGRVINVSSIGGRLAFGGGGYTPSK
YAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTGLADPIKTTEKKLAIWKHLSPDIKQQYGE
GYIEKSLHRLKSSTSSVNLDLSLVVECMDHALTSLFPKTRYTAGKDAKTFWIPLSHMPAA
LQDFLLLKEKVELANPQAV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgctgctttgggtgttggccctcctgttcctctgcgcttttctgtggaattataaaggg
cagctgaagatagcagacatcgctgacaagtacattttcatcactggatgtgactcaggc
ttcggaaacttagcagccagaacttttgatagaaaaggcttccgtgtcattgctgcctgc
ctgactgagtcaggatcagaggctttgaaggccaaaacctcagagagacttcacacagtg
cttctggatgtcaccaacccagagaatgtcaaggagactgcccagtgggtgaagagccac
gtaggagaaaaaggtctctggggtctgatcaataatgctggtgttcttggcgtactggct
cccactgactggctgacagtggacgactacagagaacccattgaagttaacctgtttgga
ctcatcaacgtgacgctgaatatgcttccactggtcaaaaaagctcgagggcgtgttatt
aatgtctccagcattggaggccgacttgcatttggtggcgggggctatactccatccaag
tatgcagtggaaggtttcaatgacagcttaaggcgggacatgaaagcttttggagtgcac
gtctcatgcattgaaccagggctgttcaaaacaggactggcagatccaataaagacaact
gaaaagaagctcgccatttggaaacatctgtctccagacatcaaacaacaatatggagag
ggctacattgaaaaaagtctacacagactgaaaagcagtacctcctctgtgaacctggac
ctctctctagtggtagagtgcatggatcacgctctaacaagtctcttccccaagactcga
tacactgctggaaaggatgccaagacattttggatacctctgtctcacatgccggcagct
ttacaagactttttactgttgaaagagaaagtagagctggccaatccccaagctgtgtga

DBGET integrated database retrieval system