KEGG   Rattus norvegicus (rat): 170668Help
Entry
170668            CDS       T01003                                 

Gene name
Rasgrp4
Definition
(RefSeq) RAS guanyl releasing protein 4
  KO
K12363  RAS guanyl-releasing protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    170668 (Rasgrp4)
   04010 MAPK signaling pathway
    170668 (Rasgrp4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    170668 (Rasgrp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF C1_1 EF-hand_7 EF-hand_6 EF-hand_1
Motif
Other DBs
NCBI-GeneID: 170668
NCBI-ProteinID: NP_570837
RGD: 620476
Ensembl: ENSRNOG00000033744
UniProt: Q8R5I4
Position
1q21
AA seq 678 aa AA seqDB search
MNRKDIKRKSHQECSGKAGGHGRPRQARRHKTCPTPREISKVMASLNLGVLSESSCSVDE
LLEECIRCFDSAGSLHRGDHILKMVLTMHSWVLPSSDLAARLLTSYQKAAKDARELRQLQ
ICYLVRYWLTHHPEVVHQEPQLEAIINRFWTTVAQEGNMAQRSLGDASNLLSPGGPGPPP
LMSSPGLGKKRKVSLLFDHLETEELAQHLTYLEFRSFQAITPQDLRGYVLQGSVRGCPAL
EGSVGLSNSVSRWVQVMVLSRPGPAQRAQVLDKFIRVAQRLRQMQNFNTLMAVTGGLCHS
AISRLKDSHVHLSPDSTKALLELTELLSSHNNYAYYRRTWASCTDFRLPVLGVHLKDLVS
LYEAHPDRLPDGRLHLPKLNSLYLRLQELAALQRQHPPCSANEDLLHLLTLSLDLFYTED
EIYELSYAREPRCPKSLPLSPFKAPVVVEWAHGVTPKPDSATLGQHVEQLVESVFKNYDP
EGHGSISLEDFEKLSANFPFACHGLHPPPRHGSGSFSREELTKYLLHASAICSKLGLAFL
HAFQEVTFRKPTFCHSCNGFVSTGPLWGVTKRGYRCQDCGLCCHRHCRDQVRVECKKRPE
TKGDPGPPGAPGPATPLPPTGCGSEEGLSYTLSPHLESGCHLHHAWTQTESSHSSWEPEM
VPCPAPVLPSKASSKSSV
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaagacatcaaaaggaagtctcatcaggaatgctctgggaaggcaggaggg
catggtcggccgagacaggcccgccgccacaagacgtgtcccaccccccgggaaatcagc
aaggtcatggcttccctgaacctgggcgtgctgagtgagagcagctgcagtgtggatgag
ctactggaggaatgcatccggtgctttgattcagctggcagcttacaccgaggggaccac
attctcaagatggtgcttaccatgcacagctgggtgctgccatcctcagaccttgccgcc
cgcctgctgacttcgtatcagaaggctgccaaagatgcccgggagctaagacagctacag
atctgttacctggtcaggtactggctgacccatcaccccgaggtagtgcaccaggaaccc
cagctggaagcaatcataaaccggttttggaccactgtagctcaggagggcaacatggcc
caaaggagcctaggagatgcctccaatctgctgagtcctggagggcccggtcccccacct
ctcatgagcagcccaggcctgggcaaaaagcggaaagtgtccttgctgttcgatcacctg
gagacagaggagctggcacagcaccttacttacctggagttccggtccttccaggccatc
acgccccaagacctgcggggctatgttttgcagggctcggtgagaggttgtcctgctctg
gaaggttctgtgggtctgagcaacagtgtgtcccgctgggtacaggtcatggtgctgagt
cgtcctgggcctgcgcagcgtgcccaggtactggacaaattcattcgtgtggcacagagg
cttcgccagatgcagaatttcaacacgctgatggcggtcacggggggtctgtgtcatagc
gccatctccagactcaaggactcccacgtccatctgagccctgacagcactaaggccctg
ctggagctgacagagcttctctcttcccacaacaactatgcctactaccgccgcacctgg
gccagctgcactgacttccggctgccagtactgggtgttcacctcaaggacctggtatct
ctgtatgaggcccatccagacaggttgccagatggccgcctgcacctacccaagctgaat
agcctctatctacggctgcaggagctggcagcactccagagacagcatcccccgtgcagt
gccaatgaggacctgctacacctgctgacgctctccctggatctcttctacacggaagat
gagatctacgagctttcttatgcccgggagccacgttgtcccaagagtctgcccctatcc
cccttcaaagcgcctgtggtggtagagtgggcccatggtgtgacgccaaagccagacagt
gcgactctgggtcagcatgtggaacagctagtggagtccgtgttcaagaactatgaccca
gaaggccatggctctatttctctggaggactttgagaagctgtcagccaacttccccttt
gcctgccatgggcttcacccacctccccgccacgggagtggctccttcagcagagaggag
ctgaccaagtatctgctccatgccagcgccatctgctccaagctgggcctggctttcctg
cacgccttccaggaggtcaccttccgcaagcccaccttctgtcacagctgcaacggcttc
gtgagcactggccctctctggggcgtcaccaagcgaggctatcgctgtcaggactgtggg
ctgtgttgtcacagacactgcagggatcaagtgagagtggagtgtaagaagaggccagag
actaaaggtgacccgggtccccctggcgcacccgggccagccacaccacttcctcctacc
ggctgtggctccgaggaaggtctctcctatacactctccccgcatctggagtctggttgc
caccttcaccatgcttggactcagacggagtcctcacactcttcctgggagccagagatg
gtgccctgcccagcaccagttttaccatccaaagcttcctcaaagtccagtgtctga

DBGET integrated database retrieval system