KEGG   Rattus norvegicus (rat): 170672Help
Entry
170672            CDS       T01003                                 

Gene name
Nphs2, podocin
Definition
(RefSeq) nephrosis 2, idiopathic, steroid-resistant
  KO
K18268  podocin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    170672 (Nphs2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   170672 (Nphs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 GatB_N Band_7_1
Motif
Other DBs
NCBI-GeneID: 170672
NCBI-ProteinID: NP_570841
RGD: 620461
Ensembl: ENSRNOG00000004030
UniProt: Q8K4G9
Position
13q22
AA seq 383 aa AA seqDB search
MDSRARSSSRKTHGRGSRSSSRDDKKSKAGRGNRGRARPDAGVERQSAGRMGTREEHRAP
AATVVNVDEVRSPGEEGRKVVALLESERPEEGIKPSGLGACEWLLVLSSLIFIIVTFPFS
IWFCIKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEVV
TKDMFIMEIDAVCYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLLAHRSLTEILLERKS
IAQDVKVALDSVTCVWGIKVERTEIKDVRLPAGLQHSLAVEAEAQRQAKVRVIAAEGEKA
ASESLRMAAEILSGTPAAVQLRYLHTLQSLSTDKPSTVVLPLPFDMLNLFSSPSNRAQGS
INYPSSPKPVEPLNPKRKDSPML
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggacagcagggcgcggagctcttccagaaagacccacgggagaggtagcaggtcctct
tctagggatgacaagaagtcaaaggccgggaggggcaacagaggccgcgcgcgcccggat
gctggggtagagcggcagagcgccgggcggatggggacccgggaggagcaccgagctcca
gcagccacggtagtgaatgtggacgaggttcgaagcccgggtgaggagggtcggaaagtg
gtggccctgctggagagcgagcgaccagaggaagggatcaagccctctggattaggggcc
tgcgagtggcttcttgtcctctcctccctgatcttcatcatcgtaacgtttcccttttcc
atctggttctgcataaaggttgttcaagaatacgaaagagtaattatattccgactggga
catctgcttcctggaagagccaaaggacctggcctgttcttttttctaccctgcctggac
acctatcacaaggttgacctccgtctccagaccttggaaatacctttccatgaggtggta
accaaagatatgttcataatggagatagacgctgtctgctactaccgcatggaaaatgcc
tcccttcttctaagcagtctagctcatgtgtccaaagccatccagttcctggtgcaaacc
accatgaagcgcctcttggcacatcgatccctcactgaaattctcctggaaaggaagagc
attgcccaagatgtaaaggttgccttggactcagtgacctgtgtttggggcatcaaagtg
gagagaactgaaattaaggatgtacggctgccagctgggcttcagcactctctggctgtg
gaagctgaggcacaaagacaggccaaagtgcgggtgattgctgccgaaggggaaaaagct
gcctctgagtccctgaggatggcggctgagattctgtcaggcaccccagctgctgtccag
ctccggtacctgcacactcttcagtccttgtccacagacaagccgtccaccgtggttttg
cctttaccctttgacatgctgaaccttttctcctctcccagcaacagagcacaaggaagc
atcaactacccaagttctcccaaacctgttgaaccactaaatcccaaaaggaaggactct
cctatgctatag

DBGET integrated database retrieval system