KEGG   Rattus norvegicus (rat): 170698Help
Entry
170698            CDS       T01003                                 

Gene name
Slco1a2, Oatp2, Slc21a5, Slco1a4
Definition
(RefSeq) solute carrier organic anion transporter family, member 1A2
  KO
K03460  solute carrier organic anion transporter family, member 1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    170698 (Slco1a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    170698 (Slco1a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC21/ASLCO: Organic anion transporter
   170698 (Slco1a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OATP MFS_1 Kazal_2 Kazal_1 OST3_OST6 TMEM208_SND2
Motif
Other DBs
NCBI-GeneID: 170698
NCBI-ProteinID: NP_571981
RGD: 621389
Ensembl: ENSRNOG00000047493
UniProt: O35913
Position
4q44
AA seq 661 aa AA seqDB search
MGKSEKRVATHGVRCFAKIKMFLLALTCAYVSKSLSGTYMNSMLTQIERQFGIPTSIVGL
INGSFEIGNLLLIIFVSYFGTKLHRPIMIGVGCAVMGLGCFLISLPHFLMGQYEYETILP
TSNVSSNSFFCVENRSQTLNPTQDPSECVKEMKSLMWIYVLVGNIIRGIGETPIMPLGIS
YIEDFAKSENSPLYIGILETGMTIGPLIGLLLASSCANIYVDIESVNTDDLTITPTDTRW
VGAWWIGFLVCAGVNILTSFPFFFFPKTLPKEGLQENVDGTENAKEKKHRKKAKEEKRGI
TKDFFVFMKSLSCNPIYMLFILISVLQFNAFINSFTFMPKYLEQQYGKSTAEVVFLMGLY
MLPPICLGYLIGGLIMKKFKVTVKKAAHLAFWLCLSEYLLSFLSYVMTCDNFPVAGLTTS
YEGVQHQLYVENKVLADCNTRCNCSTNTWDPVCGDNGLAYMSACLAGCEKSVGTGTNMVF
QNCSCIQSSGNSSAVLGLCNKGPDCANKLQYFLIIAIFGCFIYSLAGIPGYMVLLRCIKS
EEKSLGVGLHAFCIRILAGIPAPIYFGALIDRTCLHWGTLKCGEPGACRMYDINSFRRLY
LGLPAALRGASFVPAFFILRLTRTFQFPGDIESSKTDHAEMKLTLKESECTEVLRSKVTE
D
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaatctgagaaaagggttgcaacccatggggtcagatgttttgccaagatcaag
atgtttctgttggcattaacatgtgcatatgtatccaaatcattatcaggaacttatatg
aattccatgctcacacaaatagagagacaattcggtatccccacatctatagttgggctt
atcaatgggagctttgaaataggaaaccttttgttgattatatttgtgagttattttgga
acaaaacttcacagacctatcatgattggtgttggatgtgcagttatgggcctggggtgt
ttcttaatctcgctaccccatttcctcatgggccaatatgaatatgaaacgattttacct
acaagcaacgtgtcctcaaacagcttcttctgtgtggaaaacagatcccagaccttaaat
ccaacacaagacccctcagagtgtgtgaaagaaatgaaatcattaatgtggatatatgta
ctggtaggaaacataatacgtggaattggtgaaactcccatcatgcccttgggtatttcc
tacattgaagactttgccaaatctgaaaactctcctttatacattgggattttagaaaca
ggaatgaccattggccctttgattggacttctgttggcttcttcctgtgcaaacatttat
gtagacattgagtctgtgaatacagatgacctgaccataactcccacagatacacgctgg
gtcggagcttggtggatcggctttttggtctgtgcaggagtgaatatcctgaccagcttt
ccctttttcttttttcccaaaacacttccaaaggaaggattacaggagaatgtggatgga
actgaaaatgccaaagagaagaaacacagaaaaaaggccaaggaagaaaaacgaggaatc
actaaagatttctttgtgttcatgaagagcctctcctgcaatccaatttacatgcttttc
atccttataagtgttctccagttcaatgcatttatcaattcatttaccttcatgcctaag
tatctggaacagcaatatggaaaatccactgctgaggtagtcttccttatgggtctttat
atgttacctccaatatgcctcggatatttaattggtggtttgattatgaagaagttcaag
gttactgtcaagaaagctgcacacttagcattctggctctgcctgtctgagtaccttctg
tctttccttagctatgtgatgacctgtgataattttccagtggcaggcttaacaacctct
tatgaaggggttcagcaccaactatatgtggagaacaaggtccttgctgactgtaacaca
aggtgtaactgctcaacgaacacatgggatccagtgtgtggagacaatggcctggcatac
atgtcagcctgccttgcaggctgtgagaagtctgttggaacaggaaccaacatggtgttt
cagaattgcagctgcattcagtcatcgggaaactcatctgcagtcctgggcctgtgtaac
aaaggccctgactgtgccaacaagctgcagtacttcttaatcatagcaatatttggctgt
ttcatatactcgctggcaggcattccagggtatatggttcttctgaggtgtatcaagtct
gaagagaagtcacttggagttgggttacatgcattttgcataagaatattagctggcatt
cctgcacccatttactttggagctttgatagacagaacctgtttacattggggaaccctg
aaatgtggtgagcccggggcatgcaggatgtatgacataaacagcttcagacgtctttac
cttggattgccggctgcactaagaggagcaagctttgtccccgccttcttcattctaaga
cttacgaggacattccagttccctggggacattgagtcttcaaaaactgatcatgcggag
atgaagctcaccttgaaggaaagtgagtgcacagaagtcctaaggtcgaaagtgacggag
gactga

DBGET integrated database retrieval system