KEGG   Rattus norvegicus (rat): 170704Help
Entry
170704            CDS       T01003                                 

Gene name
Hrh4
Definition
(RefSeq) histamine receptor H4
  KO
K04152  histamine receptor H4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    170704 (Hrh4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    170704 (Hrh4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    170704 (Hrh4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 170704
NCBI-ProteinID: NP_571984
RGD: 620631
Ensembl: ENSRNOG00000016887
UniProt: Q91ZY1
Position
18p13
AA seq 391 aa AA seqDB search
MSESNGTDVLPLTAQVPLAFLMSLLAFAITIGNAVVILAFVADRNLRHRSNYFFLNLAIS
DFFVGVISIPLYIPHTLFNWNFGSGICMFWLITDYLLCTASVYSIVLISYDRYQSVSNAV
RYRAQHTGILKIVAQMVAVWILAFLVNGPMILASDSWKNSTNTEECEPGFVTEWYILAIT
AFLEFLLPVSLVVYFSVQIYWSLWKRGSLSRCPSHAGFIATSSRGTGHSRRTGLACRTSL
PGLKEPAASLHSESPRGKSSLLVSLRTHMSGSIIAFKVGSFCRSESPVLHQREHVELLRG
RKLARSLAVLLSAFAICWAPYCLFTIVLSTYRRGERPKSIWYSIAFWLQWFNSLINPFLY
PLCHRRFQKAFWKILCVTKQPAPSQTQSVSS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagtctaacggcactgacgtcttgccactgactgctcaagtccccttggcattt
ttaatgtccctgcttgcttttgctataacgataggcaatgctgtggtcattttagccttt
gtagcagacagaaaccttagacatcgaagtaattatttttttcttaatttggctatttct
gacttcttcgtgggtgtcatctccattcctctgtacatccctcacacgctgtttaactgg
aattttggaagtggaatctgcatgttttggctcattactgactatcttttgtgcacagca
tccgtctacagtattgtcctcattagctacgatcgataccagtcagtttcaaacgctgtg
cgttatagagcacagcacactggcatcctgaaaattgttgctcaaatggtggctgtttgg
atactggctttcttggtcaatggcccaatgattctggcttcggattcttggaagaacagc
accaacacagaggagtgcgagcctggctttgttactgagtggtacatcctcgccattaca
gcattcttggaattcctgctccctgtctccttggtggtctatttcagtgtacagatttac
tggagcctgtggaagcgtgggagtctcagtaggtgccctagccacgctggattcatcgct
acctcttccaggggcactggacactcacgcagaactgggttggcttgtaggacaagtctt
cctggattaaaggaaccagccgcatcccttcattcagaaagtccacgaggaaagagcagt
ctcctggtgtccttaaggactcacatgagcggtagtatcatcgccttcaaagtgggttcc
ttctgccgatcagaaagcccagtgcttcaccagagagagcacgtggagcttctcagaggc
aggaagctagccaggtcgctagctgtcctcctgagtgcttttgccatttgctgggctccg
tattgcctgttcacaattgttctttcaacttatcgcagaggggagcgccccaaatcgatt
tggtacagcatagccttttggctacagtggttcaattcacttattaatccctttctatac
cctttgtgccacagacgtttccagaaggctttctggaagatactctgtgtgacaaagcaa
ccagcaccttcacagacccagtcagtatcttcttga

DBGET integrated database retrieval system