KEGG   Rattus norvegicus (rat): 170816
Entry
170816            CDS       T01003                                 

Gene name
Olr59, Olfr78, Or51e2, RA1c
Definition
(RefSeq) olfactory receptor 59
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    170816 (Olr59)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    170816 (Olr59)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    170816 (Olr59)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx DUF4408
Other DBs
NCBI-GeneID: 170816
NCBI-ProteinID: NP_775415
RGD: 628858
Ensembl: ENSRNOG00000018606
UniProt: O88628
Position
1q32
AA seq 320 aa
MSSCNFTHATFMLIGIPGLEEAHFWFGFPLLSMYAVALFGNCIVVFIVRTERSLHAPMYL
FLCMLAAIDLALSTSTMPKILALFWFDSREITFDACLAQMFFIHALSAIESTILLAMAFD
RYVAICHPLRHAAVLNNTVTVQIGMVALVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH
QDVMKLAYTDTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRAVLQLPSKSERAKAFGTC
VSHIGVVLAFYVPLIGLSVVHRFGNSLDPIVHVLMGDVYLLLPPVINPIIYGAKTKQIRT
RVLAMFKISCDKDIEAGGNT
NT seq 963 nt   +upstreamnt  +downstreamnt
atgagctcctgcaacttcactcacgccaccttcatgcttatcggtattccaggactggag
gaagctcacttttggtttggcttccccctactttccatgtacgctgtagcattgtttgga
aattgcattgtggtcttcatcgtgaggacagagcggagcctgcatgcgcccatgtatctt
tttctctgcatgctggcagctattgatctggctttgtccacctctacaatgcccaagatt
ctcgccctcttttggtttgactcccgggagattacttttgatgcctgtctcgcccagatg
ttcttcattcacgctctctcagcaattgaatctaccatcttgctggccatggcctttgac
cggtatgtggctatctgccacccactgcgtcacgctgctgtgctcaacaatacagtaaca
gtccaaatcggcatggtggctctggtccggggatccctattctttttcccactcccactg
ctgatcaagcgactggccttctgccactccaatgtgctctcccactcctattgtgttcac
caggatgtgatgaagttggcctatacagacacattgcccaatgtagtctatggtctaact
gccattctgctagtcatgggtgtagatgtcatgttcatctccttgtcctatttcctgatt
atacgagcagttctgcaattgccttccaagtctgagcgagctaaggcatttggaacctgt
gtgtcacacattggtgtagtcctggctttctatgtcccactcattggcctgtcagtagtg
caccgttttggaaacagcctggatcccattgtgcatgttctcatgggcgatgtctacctg
ctgctgcctcctgtgatcaatcccatcatctacggtgctaagaccaaacagatcagaaca
cgggtgctggctatgttcaagatcagttgtgacaaggacattgaagctggaggaaacacg
tga

DBGET integrated database retrieval system