KEGG   Rattus norvegicus (rat): 170818
Entry
170818            CDS       T01003                                 

Gene name
Icmt, fcmt
Definition
(RefSeq) isoprenylcysteine carboxyl methyltransferase
  KO
K00587  protein-S-isoprenylcysteine O-methyltransferase [EC:2.1.1.100]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    170818 (Icmt)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.100  protein-S-isoprenylcysteine O-methyltransferase
     170818 (Icmt)
SSDB
Motif
Pfam: ICMT PEMT DUF1295
Other DBs
NCBI-GeneID: 170818
NCBI-ProteinID: NP_579844
RGD: 621618
Ensembl: ENSRNOG00000010953
UniProt: Q9WVM4
Position
5q36
AA seq 284 aa
MAGCAARVPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAGLNALLLLLYR
PPRYQIAIRACFLGFVFGCGVLLSFSQSSWNHFGWYVCSLSLFHYSEYLVTAVNNPKSLS
LDSFLLNHSLEYTVAALSSWIEFTLENIFWPELKQITWLSAAGLLMVIFGECLRKVAMFT
AGSNFNHVVQSEKSDTHTLVTSGVYAWCRHPSYVGWFYWSIGTQVMLCNPICGVVYALTV
WRFFRDRTEEEEISLIHFFGEEYLDYKKRVPTGLPFIKGVKVGL
NT seq 855 nt   +upstreamnt  +downstreamnt
atggcgggctgcgcggcgcgggttccgccgggctccgaggcgcgcctcagcctcgctacc
ttcctccttggtgcctcggtgctcgctctgcctctgctcacgcgcgccggcctgcagggc
cgcaccgggctggcgctgtacgtggccggactcaacgcgctgttgctgcttctctaccgg
ccgccgcgctaccagatagccatccgagcttgtttccttggctttgtgtttggctgcggc
gtgctgctaagtttcagccagtcctcctggaatcacttcggctggtacgtgtgctcgctc
tccctgttccactactctgagtacctagtgacagctgtcaataatcccaaaagtctgtcc
ttggactccttcctcctgaaccacagtctggagtacacagtggctgccctgtcttcctgg
atagagttcacccttgaaaacatcttttggccagaactgaagcagattacctggctcagt
gccgctgggctgttgatggtgatctttggagaatgcctgaggaaagtggccatgtttaca
gccggctccaacttcaaccacgtggtacagagtgaaaagtcagacacccacactctcgtg
acaagtggggtatacgcttggtgccggcacccctcctatgtgggctggttttactggagt
attggaacccaggtgatgctgtgtaatcccatctgtggtgtggtctatgccctgacggtg
tggcgcttcttccgtgatcgcacagaggaggaggagatctcgctgattcacttctttggg
gaagaatacttggactataagaagagggtgcccacaggcctgcctttcataaagggggtc
aaggtggggctatga

DBGET integrated database retrieval system