KEGG   Rattus norvegicus (rat): 170837Help
Entry
170837            CDS       T01003                                 

Gene name
Snrk
Definition
(RefSeq) SNF related kinase
  KO
K08802  SNF related kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    170837 (Snrk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     170837 (Snrk)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   170837 (Snrk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 170837
NCBI-ProteinID: NP_620188
RGD: 69653
Ensembl: ENSRNOG00000004050
UniProt: Q63553
Position
8q32
AA seq 746 aa AA seqDB search
MAGFKRGYDGKIAGLYDLDKTLGRGHFAVVKLARHVFTGEKVAVKVIDKTKLDTLATGHL
FQEVRCMKLVQHPNIVRLYEVIDTQTKLYLILELGDGGDMFDYIMKHEEGLNEDLAKKYF
AQIVHAISYCHKLHVVHRDLKPENVVFFEKQGLVKLTDFGFSNKFQPGKKLTTSCGSLAY
SAPEILLGDEYDAPAVDIWSLGVILFMLVCGQPPFQEANDSETLTMIMDCKYTVPPRVSA
GCRDLITRMLQRDPKRRASLEEIESHPWLQGVDPSPATKYNIPLVSYKNLSEEEHNSIIQ
RMVLGDIADRDAIVEALETNRYNHITATYFLLAERILREKQEKEIQTRSASPSNIKAQFR
QSWPTKIDVPQDLEDDLTATPLSHATVPQSPARAGDSVLNGHRSKGLCDPAKKDELPELA
GPALSTVPPASLKPAASGRKCLFRVEEDEEEDEEDKKPVSLSTQVVLRRKPSVTNRLTSR
KSAPVLNQIFEEGESDDEFDMDENLPPKLSRLKMNIASPGTVHKRYHRRKSQGRGSSCSS
SETSDDDSESRRRLDKDSGLAYSWHRRDSSEGPPGSEGDGGGQSKPSGGGGVDKASPGEQ
GTGGSGQGGSGGTPSGTAGSSRRCAGPDSSSSSPASAAPRGAELVQSLKLVSLCLGSQLH
GAKYILDPQKALLSSVKVQERSTWKMCISAPGPGPSADLDPVRTKKLRNNVLQLPLCEKT
ISVNIQRSRKEGLLCASSPASCCHVI
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggcagggttcaagcgaggctatgatggaaaaattgctggattgtatgatctggataaa
accttgggtcgaggtcacttcgcagtggtcaaactggccaggcatgtcttcacaggtgag
aaggtggcagtgaaagtcattgacaagacaaagctggacactctagccactggtcacctc
ttccaggaagtcaggtgcatgaagctagtgcagcaccccaacatcgtgcgtctctatgag
gtcatagacacccagaccaaactgtatctcattctagaacttggagatggaggagatatg
tttgactacataatgaagcacgaggagggtcttaatgaagacttggcaaagaagtacttt
gctcagatagttcacgctatatcctattgccataaactccatgtggttcacagagacttg
aaaccagagaatgtagtcttttttgaaaaacaaggtcttgtgaagttgacagactttggc
ttcagcaacaagtttcagcctggaaagaagctcactacaagctgtggatctcttgcgtac
tctgctccggaaatcctgcttggcgatgagtacgatgcccctgcagtagacatatggagc
ctgggtgtgatccttttcatgctggtgtgtgggcagccgcccttccaagaagccaacgac
agtgagacgctgaccatgatcatggactgcaagtacactgtgccgccccgtgtgtctgca
gggtgcagggacctcatcacacggatgctgcagagagaccccaaaaggagagcctctctg
gaagagattgaaagccacccttggctccagggagtggacccctcaccagccaccaagtat
aacattcccctcgtgtcctacaagaacctctcggaagaggagcacaatagcatcatccag
cgcatggtgcttggggacatcgcagatcgagatgccatcgtagaagccctggaaaccaac
aggtacaaccacatcaccgccacttacttcttacttgctgaaaggatcctgcgagaaaag
caagagaaagaaatacagaccaggtctgcaagccccagcaacatcaaggcccagttcagg
cagtcgtggccaactaaaattgatgttccccaagaccttgaagatgatctcactgccacc
cctctgtcacatgccacagtcccgcagtctcctgctcgggctggtgacagtgtcctcaat
ggccacaggagcaaaggcctgtgtgaccctgccaagaaagatgagctcccggagctggcg
gggccagcactgtccactgttccacccgcaagcctgaagcccgcagccagtgggcggaag
tgtctcttcagggtggaagaagatgaagaggaagatgaggaggacaagaagcctgtgtcc
ctgtccacgcaggtggtgctgcgccggaagccatcagtcaccaaccgcctgacatctcga
aagagtgccccggtgctcaatcagatcttcgaggaaggcgagtctgacgacgagtttgac
atggacgagaacctaccacccaagctgagccggctgaagatgaacatcgcgtcaccaggc
acagtgcacaagcgctaccaccgcaggaaaagccagggccgtggctcgagctgcagcagc
tctgagaccagcgatgatgactctgagagccgccggcggctggacaaggacagtggcttg
gcttactcgtggcaccggcgtgacagcagtgaggggccaccaggcagtgagggcgatggt
ggcggtcagagcaaacctagcggcggtggtggtgtggacaaggcgagtccaggagagcag
ggcacgggcggcagtggccagggaggctcaggtgggaccccatcgggtacagcaggttcc
tccaggcgctgtgcaggccctgactcctcctcatcctcccccgcctctgccgctccacgt
ggtgcagagcttgtgcagagcctcaaactcgtgagcctgtgtctaggctcgcagctccat
ggcgccaagtacattctggacccgcagaaggccttgttgtccagcgtgaaggtgcaggag
aggtccacttggaagatgtgcatcagtgccccaggccccggcccctctgctgaccttgac
cctgtgaggaccaagaagctgaggaacaacgtgctccagctacctctgtgcgagaagacc
atctccgtgaacatccaacgcagccgcaaggaagggctgctctgcgcctccagccccgcc
agctgctgccacgtcatctga

DBGET integrated database retrieval system