KEGG   Rattus norvegicus (rat): 170840Help
Entry
170840            CDS       T01003                                 

Gene name
Slc40a1, Fpn1, Slc11a3, Slc39a1
Definition
(RefSeq) solute carrier family 40 member 1
  KO
K14685  solute carrier family 40 (iron-regulated transporter), member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04216  Ferroptosis
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    170840 (Slc40a1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    170840 (Slc40a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    170840 (Slc40a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC40: Basolateral iron transporter
   170840 (Slc40a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FPN1 DUF347 DUF5373
Motif
Other DBs
NCBI-GeneID: 170840
NCBI-ProteinID: NP_579849
RGD: 620180
Ensembl: ENSRNOG00000049995
UniProt: Q923U9 G3V6H7
Position
9q22
AA seq 570 aa AA seqDB search
MTKSRDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLL
TAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVILCGIILMMVFLHKNEL
LNMYHGWVLTVCYILIITIANIANLASTATAITIQRDWIVVVAGENRSRLADMNATIRRI
DQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYFLLWKVYQKTPALAVKAALK
VEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQEPTCASQIAEPFRTFRDGWV
SYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSVLMGASAITGIMGTVAF
TWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLDLSVSPFEDIRSRFIHEEAVSS
TTKIPETEMLMSNVSNVVNTVHEMSTKSVPIISVSLLFAGVIAARIGLWSFDLTVTQLLQ
ENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGHLMYFRF
AQKTLGNQIFVCAPDEKEVTDESQPNTSVV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagtcaagagatcagacccatcaggaaggatgctgtggatctttagcaaactac
ctgacctcagcaaaattcctcctctaccttggccactctctctccacttggggggatcgg
atgtggcactttgcagtgtctgtgtttctggtggaactctacggaaacagcctcctcttg
acagctgtctacgggttggtggtggcaggctctgttctggtcctgggagccatcattggt
gactgggtggataagaatgccagacttaaagtggcccagacgtccctggtggttcagaat
gtatcagtcattctctgcgggatcatcctgatgatggttttcttacacaagaatgagctt
ctgaacatgtatcatggatgggtccttactgtctgctacatcctgatcatcaccattgca
aacattgcgaatttggccagtactgccactgcaattacaatccaaagggactggattgtt
gtcgtagcaggagaaaacaggagcagattagcagacatgaatgctaccattagaaggatt
gaccagctaaccaacatcctggcccccatggctgttggccagattatgacattcggttcc
ccagtcattggctgtggtttcatttctggttggaatttggtgtccatgtgtgtggagtac
ttcttgctctggaaggtttaccagaagacccctgctctggctgtaaaagctgctctcaag
gtagaggagtcagaactgaagcagctgacctcacctaaagatactgagccaaaacctttg
gagggaactcacctaatgggtgagaaagactctaacatccgtgaacttgaatgtgaacaa
gaacccacctgtgcctcccagatcgcagaacccttccgcacttttcgagatggatgggtc
tcctactataaccagcccgtatttttggctggcatgggcctggctttcctctatatgaca
gtcctgggcttcgactgtatcaccacaggatatgcttacactcagggactgagtggttcc
atcctcagtgttttgatgggagcatcagcaataactggaataatgggaactgtggccttc
acttggctacgtcgaaaatgtggccttgttcggactggtctgttctcaggactggctcag
ctttcttgtttgatcttgtgtgtgatctccgtgttcatgcctggaagccccttggacctg
tctgtttctccatttgaagatatccgttctaggtttatacatgaggaggcagtgtcctca
actaccaaaatacctgaaacagaaatgcttatgtctaatgtgtctaatgttgtcaatacc
gtccatgagatgagtactaaatccgtccccataatctccgtcagcctgctgtttgcagga
gtcattgctgctagaatcggtctttggtcctttgatttgactgtgacacagttgctgcaa
gaaaatgtaattgaatcagaaagaggcattatcaatggtgtgcagaactccatgaactac
cttctcgaccttctgcatttcatcatggtcatcttggccccaaatcctgaagcttttggc
ttgctagtattgatttcagtctcctttgtggcaatgggacatcttatgtatttccgtttt
gcccagaagactctgggcaaccagatttttgtttgtgctcctgatgaaaaggaagttaca
gatgaaagtcagcctaatacatctgttgtgtaa

DBGET integrated database retrieval system