KEGG   Rattus norvegicus (rat): 170851
Entry
170851            CDS       T01003                                 

Gene name
Map2k1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04218  Cellular senescence
rno04270  Vascular smooth muscle contraction
rno04370  VEGF signaling pathway
rno04371  Apelin signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04540  Gap junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04668  TNF signaling pathway
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05034  Alcoholism
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    170851 (Map2k1)
   04012 ErbB signaling pathway
    170851 (Map2k1)
   04014 Ras signaling pathway
    170851 (Map2k1)
   04015 Rap1 signaling pathway
    170851 (Map2k1)
   04370 VEGF signaling pathway
    170851 (Map2k1)
   04371 Apelin signaling pathway
    170851 (Map2k1)
   04668 TNF signaling pathway
    170851 (Map2k1)
   04066 HIF-1 signaling pathway
    170851 (Map2k1)
   04068 FoxO signaling pathway
    170851 (Map2k1)
   04072 Phospholipase D signaling pathway
    170851 (Map2k1)
   04071 Sphingolipid signaling pathway
    170851 (Map2k1)
   04024 cAMP signaling pathway
    170851 (Map2k1)
   04022 cGMP-PKG signaling pathway
    170851 (Map2k1)
   04151 PI3K-Akt signaling pathway
    170851 (Map2k1)
   04150 mTOR signaling pathway
    170851 (Map2k1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    170851 (Map2k1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    170851 (Map2k1)
   04210 Apoptosis
    170851 (Map2k1)
   04218 Cellular senescence
    170851 (Map2k1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    170851 (Map2k1)
   04540 Gap junction
    170851 (Map2k1)
   04550 Signaling pathways regulating pluripotency of stem cells
    170851 (Map2k1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    170851 (Map2k1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    170851 (Map2k1)
   04620 Toll-like receptor signaling pathway
    170851 (Map2k1)
   04650 Natural killer cell mediated cytotoxicity
    170851 (Map2k1)
   04660 T cell receptor signaling pathway
    170851 (Map2k1)
   04662 B cell receptor signaling pathway
    170851 (Map2k1)
   04664 Fc epsilon RI signaling pathway
    170851 (Map2k1)
   04666 Fc gamma R-mediated phagocytosis
    170851 (Map2k1)
   04062 Chemokine signaling pathway
    170851 (Map2k1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    170851 (Map2k1)
   04929 GnRH secretion
    170851 (Map2k1)
   04912 GnRH signaling pathway
    170851 (Map2k1)
   04915 Estrogen signaling pathway
    170851 (Map2k1)
   04914 Progesterone-mediated oocyte maturation
    170851 (Map2k1)
   04917 Prolactin signaling pathway
    170851 (Map2k1)
   04921 Oxytocin signaling pathway
    170851 (Map2k1)
   04926 Relaxin signaling pathway
    170851 (Map2k1)
   04935 Growth hormone synthesis, secretion and action
    170851 (Map2k1)
   04919 Thyroid hormone signaling pathway
    170851 (Map2k1)
   04928 Parathyroid hormone synthesis, secretion and action
    170851 (Map2k1)
   04916 Melanogenesis
    170851 (Map2k1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    170851 (Map2k1)
  09156 Nervous system
   04725 Cholinergic synapse
    170851 (Map2k1)
   04726 Serotonergic synapse
    170851 (Map2k1)
   04720 Long-term potentiation
    170851 (Map2k1)
   04730 Long-term depression
    170851 (Map2k1)
   04722 Neurotrophin signaling pathway
    170851 (Map2k1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    170851 (Map2k1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    170851 (Map2k1)
   05206 MicroRNAs in cancer
    170851 (Map2k1)
   05205 Proteoglycans in cancer
    170851 (Map2k1)
   05230 Central carbon metabolism in cancer
    170851 (Map2k1)
   05231 Choline metabolism in cancer
    170851 (Map2k1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    170851 (Map2k1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    170851 (Map2k1)
   05212 Pancreatic cancer
    170851 (Map2k1)
   05225 Hepatocellular carcinoma
    170851 (Map2k1)
   05226 Gastric cancer
    170851 (Map2k1)
   05214 Glioma
    170851 (Map2k1)
   05216 Thyroid cancer
    170851 (Map2k1)
   05221 Acute myeloid leukemia
    170851 (Map2k1)
   05220 Chronic myeloid leukemia
    170851 (Map2k1)
   05218 Melanoma
    170851 (Map2k1)
   05211 Renal cell carcinoma
    170851 (Map2k1)
   05219 Bladder cancer
    170851 (Map2k1)
   05215 Prostate cancer
    170851 (Map2k1)
   05213 Endometrial cancer
    170851 (Map2k1)
   05224 Breast cancer
    170851 (Map2k1)
   05223 Non-small cell lung cancer
    170851 (Map2k1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    170851 (Map2k1)
   05170 Human immunodeficiency virus 1 infection
    170851 (Map2k1)
   05161 Hepatitis B
    170851 (Map2k1)
   05160 Hepatitis C
    170851 (Map2k1)
   05164 Influenza A
    170851 (Map2k1)
   05163 Human cytomegalovirus infection
    170851 (Map2k1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    170851 (Map2k1)
   05165 Human papillomavirus infection
    170851 (Map2k1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    170851 (Map2k1)
   05135 Yersinia infection
    170851 (Map2k1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    170851 (Map2k1)
   05022 Pathways of neurodegeneration - multiple diseases
    170851 (Map2k1)
  09165 Substance dependence
   05034 Alcoholism
    170851 (Map2k1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    170851 (Map2k1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    170851 (Map2k1)
   01522 Endocrine resistance
    170851 (Map2k1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    170851 (Map2k1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     170851 (Map2k1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE7 family
   170851 (Map2k1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like Seadorna_VP7 Haspin_kinase NAD_binding_6
Other DBs
NCBI-GeneID: 170851
NCBI-ProteinID: NP_113831
RGD: 70495
Ensembl: ENSRNOG00000010176
UniProt: Q01986
Position
8
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAASI
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgatggctccgcggtt
aacgggaccagctcggccgagaccaacctggaggccttgcagaagaagctggaggagctg
gagctggacgagcagcagcggaagcgccttgaggcctttctgacgcagaagcagaaggtg
ggagagttgaaggatgatgactttgagaagatcagtgaactgggggctggcaatggtgga
gtggtgttcaaggtctcccacaagccatctggcctggttatggctaggaagctaattcac
ctggagatcaaacccgcaatccggaaccagatcatccgggagctgcaggtgctgcatgag
tgcaactccccgtacatagtgggcttctacggggccttctacagtgacggcgagatcagc
atctgcatggagcacatggatggtgggtccttggatcaagtgctgaagaaagctggaaga
attcctgagcaaattttaggaaaagtcagcatcgctgtgataaaaggcctgacatatcta
cgagagaagcacaagattatgcacagagatgtcaagccttccaacattctagtgaactca
cgtggggagatcaaactctgcgattttggggtcagcgggcagctaattgactccatggcc
aactccttcgtgggaacaaggtcctacatgtcgcctgagagactccaggggactcactac
tctgtgcagtcggacatctggagcatggggctctctctggtggagatggcagttggaaga
taccccattcctcctcctgatgccaaggagctggagctgctgtttggatgccaggtggaa
ggagacgcggccgaaacgccacccaggccaaggacccctgggaggcccctcagctcatat
ggaatggatagccgacctcccatggcaatttttgagttgttggattacatcgtcaatgag
cctcctccaaaactgcccagtggagtattcagtctggaatttcaggattttgtgaataag
tgcttaataaagaaccctgcagagagagcagatctgaagcagctcatggtacatgctttc
atcaagagatctgatgccgaggaggtagacttcgcaggctggctctgctccaccattggg
cttaaccagcccagcacaccaacccacgctgccagcatctga

DBGET integrated database retrieval system