KEGG   Rattus norvegicus (rat): 170897
Entry
170897            CDS       T01003                                 

Gene name
Sphk1
Definition
(RefSeq) sphingosine kinase 1 isoform b
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04370  VEGF signaling pathway
rno04371  Apelin signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno05152  Tuberculosis
Module
rno_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    170897 (Sphk1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    170897 (Sphk1)
   04371 Apelin signaling pathway
    170897 (Sphk1)
   04020 Calcium signaling pathway
    170897 (Sphk1)
   04072 Phospholipase D signaling pathway
    170897 (Sphk1)
   04071 Sphingolipid signaling pathway
    170897 (Sphk1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    170897 (Sphk1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    170897 (Sphk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     170897 (Sphk1)
SSDB
Motif
Pfam: DAGK_cat YegS_C
Other DBs
NCBI-GeneID: 170897
NCBI-ProteinID: NP_001257736
RGD: 620048
Ensembl: ENSRNOG00000010626
UniProt: Q91V26 A0A0G2JWE5
Position
10
AA seq 383 aa
MQPADCPRGLLPRPCRVLVLLNPRGGKGKALKLFQSRVRPLLEEAEVSFKLMLTERQNHA
RELVCAEELGHWDALAVMSGDGLMHEVVNGLMERPDWESAIQKPLCSLPGGSGNALAASL
NYYAGHEQVTNEDLLINCTLLLCCRQLSPMNLLSLHTASGRQLYSVLSLSWGFVADVDLE
SEKYRSLGEIRFTVGTFFRLASLRIYQGQLAYLPVGKAASKIPASSLAQKGPANTYLVPL
EEPVPPHWTVVPEQDFVLVLVLLHTHLSTEMFAAPMGRCEAGVMHLFYIRAGVSRAMLLR
LFLAMQKGKHMDLDCPYLVHVPVVAFRLEPRNQRGVFSVDGELMVCEAVQGQVHPNYLWM
VSGSSDSPSGRDSQRRPPPEEPI
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgcaaccagcagactgtccccggggactgctcccacggccatgcagagtgttggtgctg
ctgaacccccggggtggcaagggcaaggctctgaagctctttcagagccgtgtgcggccc
cttctggaggaggctgaggtatcctttaaactgatgctcaccgaacggcagaaccatgcc
agggagctggtgtgtgcagaagaactgggtcactgggatgccttggcggtcatgtccggt
gacggtctgatgcacgaggtggtgaatgggctaatggaacgacctgactgggagagtgcc
atccagaaacccctatgtagcctccctggaggctctggcaatgcgctggcagcttctttg
aactactatgctgggcacgagcaggtcactaatgaagatctcctgatcaactgcacactg
ctgttatgctgccggcagctgtcacccatgaatctgctgtccctgcacaccgcttccgga
cggcaactctattctgttctcagtctgtcctggggtttcgttgctgacgtggacttggag
agtgagaaatacaggagcttgggggagattcgtttcacggtgggaaccttttttcgccta
gcaagcctgcgcatttaccaaggccaactggcctaccttcctgtagggaaggctgcctct
aagatacctgcttcctcactggcacagaagggccctgccaacacatacctcgttcctctg
gaggagccagtgccacctcattggactgtggtgccagagcaggacttcgttctggtgctg
gtgctgcttcacacccacctgagcacagagatgtttgcagcacccatgggccgctgcgag
gctggtgttatgcatctgttctatatacgtgcgggggtgtcaagggccatgctgctgcgc
ctcttcctggccatgcagaagggcaagcatatggacctcgactgcccgtacttggttcat
gtgccagtggttgccttccgcctggaacccaggaaccagaggggagtgttttctgtggac
ggggagctgatggtgtgtgaagctgtgcagggccaagtgcacccaaactacctttggatg
gtctctggtagcagtgactccccgtccggccgggactcccagcggaggccacctccagaa
gaaccaatatga

KEGG   Rattus norvegicus (rat): 308589
Entry
308589            CDS       T01003                                 

Gene name
Sphk2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04370  VEGF signaling pathway
rno04371  Apelin signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno05152  Tuberculosis
Module
rno_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    308589 (Sphk2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    308589 (Sphk2)
   04371 Apelin signaling pathway
    308589 (Sphk2)
   04020 Calcium signaling pathway
    308589 (Sphk2)
   04072 Phospholipase D signaling pathway
    308589 (Sphk2)
   04071 Sphingolipid signaling pathway
    308589 (Sphk2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    308589 (Sphk2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    308589 (Sphk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     308589 (Sphk2)
SSDB
Motif
Pfam: DAGK_cat YegS_C
Other DBs
NCBI-GeneID: 308589
NCBI-ProteinID: NP_001012066
RGD: 1307757
Ensembl: ENSRNOG00000021032
UniProt: Q6AYB2
Position
1
AA seq 616 aa
MAPPPLLPVAASTPILHGEFGSYPAHGPRFALTLTTQALHIQRLRPKPEARPRDGLVPLD
EVSGCGTLQSRSPEDTAAYFCIYTYPRGRRGGRRRATRTFRADGAATYVENRAEAQRWAT
ALMCLLRGVPLSGDQEITPELLPRKPRLLLLVNPFGGRGLAWQRCMDHVVPMISEAGLSF
NLIQTERQNHARELVQGLSLSEWEGIVTVSGDGLLYEVLNGLLDRPDWEDAVRMPIGVLP
CGSGNALAGAVNHHGGFEQTVGVDLLLNCSLLLCRGGSHPLDLLSVTLASGSRCFSFLSV
AWGFLSDVDIHSERFRALGSARFTLGAVLGLATLHTYRGRLSYLPATTEPALPIPGHGLP
RAKSELALAPAPAPAATHSPLHRSVSDLPLPLPQPALASPGSPEPLPDLSLNGGGPELTG
DWGGAGDAPLSPDPLLPSSPNAFKTAQLSPIAEGPSEMPASGLLPPIHNAPEASTWGPAD
HLLPPLGSPLPQDWVTIEGEFVLMLAILPSHLCADLMAAPHARFDDGVVHLCWVRSGISR
AALLRILLAMEHGNHFSLGCPHLGYAAARAFRLEPLTPRGVLTVDGELVEYGPIQAQVHP
SLATLLTGPAGQKPRA
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggccccaccaccactactgccagtggctgccagcactccgatcctgcacggcgagttt
ggttcctacccagcccatggccccaggtttgccctcaccctcacgacacaagccctacac
atacagcgactgcgcccaaagccagaagcccggccccgagatggtctagtccctctggac
gaggtctcaggctgtggcactctgcagagccgtagccccgaagacactgcagcctacttc
tgcatctacacctacccacgtggccggcgtgggggccggcgcagagctactcgtaccttc
cgggccgacggggccgccacttatgtggagaatcgtgcagaggcccagcgttgggcaact
gctctcatgtgtctcctccgaggagtgcctctgtctggggaccaggaaatcacccctgaa
ttgctgccccggaagcccaggctgctcctattggtcaatccttttggggggcggggcctg
gcctggcagcgctgtatggaccacgtggtgcccatgatctctgaagctgggctgtccttc
aacctcatacagacagaacgacaaaaccatgcacgtgagctggtgcaggggttgagcctg
agtgagtgggaaggcattgtcactgtgtccggagatgggctgctttatgaggtgctgaat
gggctcctcgaccgcccagattgggaagacgctgtgcggatgcccattggtgtcctcccc
tgtggttcgggcaatgcactagctggggcagttaaccatcatggcgggtttgagcaaact
gttggtgttgacctgttgctcaactgctcgcttcttctctgccggggtggcagccatcct
ctggacctgctctctgtgacgctagcctcaggatcccgctgtttttccttcctgtcagtt
gcctggggattcttgtcagatgtggacattcacagcgagcgcttcagagccctgggcagt
gctcgattcacactgggtgcagtgctaggcctggccacattgcatacctaccgtggacgt
ctctcctacctccctgctaccacagaaccagccttgcccatcccaggccatggtctgcca
agagccaagtcagaactagccttggccccagccccagccccagccgccacccactcacct
cttcatcgatctgtgtctgacctgcccctgcctcttccccagcctgccctggcctcccct
ggctcccctgagcccctgcctgacctgtccctcaatggtggtggtccagagctgactgga
gactgggggggagctggggatgcacctttgtccccagacccattgctgccttcatccccc
aacgctttcaaaacagctcagctttcacccatcgccgaagggccctcagaaatgccagca
tcagggctgctgcctcccatccacaatgctccagaagcctctacctggggcccagcggac
cacctgctccctcccctgggctctccactgccccaagactgggtgacaatagagggggag
tttgtactcatgttggccatcttgccaagccacctctgcgcagacctgatggcagcccca
cacgcgcgttttgacgatggtgtggtgcacctgtgctgggtgcggagcggcatctcacgg
gccgcacttctacgaattttgctggccatggaacatggaaaccacttcagcctgggctgc
ccacatctgggctatgctgcagcacgtgccttccgccttgagccactcacgcctcgtggg
gtgctcactgtagatggggaattagtagagtatgggccaatacaggcacaggtgcatcca
agtctcgccacactgctcactgggcctgcaggtcaaaagcctcgagcctga

DBGET integrated database retrieval system