KEGG   Rattus norvegicus (rat): 170900
Entry
170900            CDS       T01003                                 

Gene name
Rbm14, CoAA
Definition
(RefSeq) RNA binding motif protein 14
  KO
K13189  RNA-binding protein 14
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    170900 (Rbm14)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    170900 (Rbm14)
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_occluded DbpA
Other DBs
NCBI-GeneID: 170900
NCBI-ProteinID: NP_596879
RGD: 620542
Ensembl: ENSRNOG00000045568
UniProt: M0R9Q1
Position
1q43
AA seq 669 aa
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGAVRAIEALHGHEL
RPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHME
KEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPALAIQSGDKTKKPGAGDTAFPGTGG
FSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQ
PSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAAS
SLGPYGGVQPSASALSTYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRA
AASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYSAQSAPYAAQ
QAASYSSQPAAYVAQPAAAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASM
GLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASY
RGQPGSAYDGTGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSK
RYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQ
MHSGYQRRM
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgaagatctttgtaggcaatgtcgacggggcggatacgacgccggaggagctggcagcc
ctcttcgcgccctatggcacggtcatgagctgcgccgtcatgaaacagtttgccttcgtg
cacatgcgcgagaacgctggcgcggtgcgcgccatcgaggccctgcatggccacgagctg
cgtccaggtcgcgcgctcgtggtggagatgtcgcgcccgaggcccctgaacacttggaag
attttcgtgggcaatgtatcggctgcatgcacaagccaggaattgcgcagcctgttcgag
cgccgtggacgcgtcatcgagtgtgacgtggtaaaagactacgcgtttgttcacatggag
aaggaagcagatgccaaagccgccatcgcgcagctcaacggcaaagaagtgaagggcaag
cgcatcaacgtggaactctcaaccaaggggcagaagaaggggcctgccctggctatccag
tctggggacaagaccaagaaaccaggggctggggatacagcattccctggaactggtggc
ttctctgccaccttcgactaccagcaggcttttggcaacagcactggtggctttgatggg
caagcccgtcagcccacaccaccattctttggtcgcgaccgcagccccctgcgccgttca
cctcctcgagcctcttatgtggctcctctgacggcccagccagccacctaccgggcccaa
ccctctgtgtctctgggagctgcatatagggcccagccttcggcctctttgggtgtcggc
tatcggactcagcccatgacagcccaggcagcttcgtaccgtgctcaaccctctgtctcc
cttggggccccatacaggggtcaactggctagccctagttcccagtctgctgcagcttcc
tcacttggcccatatggtggagtccagccctcagcctcagccctttccacctatgggggt
caggcagctgcagcttcttcgcttaattcctatggggctcagggctcctcccttgcttcc
tatggtaaccagccatcctcttatggcgcccaggctgcctcttcatatggggttcgtgcg
gctgcttcttcctataacacacagggagcagcttcttccctaggttcctatggggctcaa
gcagcctcctatggtgcccagtctgcagcctcctcactagcttatggagcccaggcagcc
tcttacaatgcccagccctcagcctcttacagtgcccagtctgccccatatgctgcacaa
caggctgcttcttattcttcccagcctgctgcttatgtggcacagccagccgcagctgct
gcctatgctagccagccagctgcctatgctgcacaggccactaccccaatggccggttcc
tatggggctcaaccagttgttcagacccagctgaatagttatggagctcaagcatctatg
ggcctgtcaggctcatatggagctcagtctgctgctgcggccactggctcctatggtgca
gcagctgcctatggggcgcagccttctgccaccttggcagctccttaccgcactcagtca
tcagcctcattggctgcttcctatgctgcccagcagcatccccaggctgctgcctcctac
cgtggccagccgggcagtgcctacgatgggacaggccagccgtcagcagcctacctgtct
atgtcccagggggccgttgccaacgccaacagcaccccaccgccctatgagcgtacccgc
ctctccccaccccgggccagctacgacgatccctacaaaaaggctgtcgccatgtcgaaa
aggtatggttccgaccggcgtttagccgagctctctgattaccgccgtttatcagagtcg
cagctttcgttccgccgctcgccgacaaagtcctcgctggattaccgtcgcctgcccgat
gcccattccgattacgcacgctattcgggctcctataatgattacctgcgggcagctcag
atgcactctggctaccagcgccgcatgtag

DBGET integrated database retrieval system