KEGG   Rattus norvegicus (rat): 170905Help
Entry
170905            CDS       T01003                                 

Gene name
Lfng
Definition
(RefSeq) LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00514  Other types of O-glycan biosynthesis
rno04330  Notch signaling pathway
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    170905 (Lfng)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    170905 (Lfng)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    170905 (Lfng)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    170905 (Lfng)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     170905 (Lfng)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  O-Glycan
   170905 (Lfng)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T Fur_reg_FbpA
Motif
Other DBs
NCBI-GeneID: 170905
NCBI-ProteinID: NP_596884
RGD: 620587
Ensembl: ENSRNOG00000001250
UniProt: Q924T4
Position
12q11
AA seq 378 aa AA seqDB search
MLQRCGRRLLLALVGALLACLLVLTADPPPTPVPAERGRRALRSLAGSSGAAPGPGSRAA
VDPGVLVREVHSLSEYFSLLTRARRDADPPPGVASRQGDGHPRPPAEVLSPRDVFIAVKT
TRKFHRARLDLLFETWISRHKEMTFIFTDGEDEALAKHTGNVVLTNCSAAHSRQALSCKM
AVEYDRFIESGKKWFCHVDDDNYVNLRALLRLLASYPHTQDVYIGKPSLDRPIQATERIS
EHRVRPVHFWFATGGAGFCISRGLALKMGPWASGGHFMSTAERIRLPDDCTIGYIVEALL
GVPLIRSGLFHSHLENLQQVPTTELHEQVTLSYGMFENKRNAVHIKGPFSVEADPSRFRS
IHCHLYPDTPWCPRTAIL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgctccagcgctgcggccggcgcctactgctggcgctggtgggtgcgctgctggcttgt
ctcctggtgctcaccgccgacccgccgccaactccggtgcccgctgagcgcggaaggcgc
gcgctgcgtagcctggcgggctcctctggggcggctccgggtccagggtccagggcggcc
gtggatcccggagtcctcgtccgcgaggtgcacagcctttccgagtacttcagtctactc
acccgcgcgcgcagagacgccgatccaccgcccggggtcgcttctcgccagggcgacggc
catccgcgtccccccgccgaggttctgtcccctcgcgatgtcttcatcgccgtcaagacc
accagaaagtttcaccgcgcgcggcttgacctgctgttcgagacctggatctcgcgccac
aaggagatgacattcatcttcacggacggggaggatgaagctttggccaagcacacaggc
aatgtggtactcaccaactgctctgcggcccacagccgccaggcgctgtcttgcaagatg
gctgtggagtacgaccgtttcattgagtcggggaagaagtggttctgccacgtggacgat
gacaactacgtcaacctccgggcactgctgcggctgctggccagctatccccacacccaa
gacgtgtacatcggcaagcccagcctggacagacccatccaggccacggagcggatcagc
gagcacagagtgagacctgtccacttttggtttgccaccggaggagctggcttctgcatt
agccgaggactggccctaaagatgggcccatgggccagtgggggacacttcatgagcaca
gcagagcgcatccgcctcccggatgattgcaccattggctacattgtggaggctctgctg
ggcgtgcccctcatccggagtggcctcttccactcgcacctggagaacctgcagcaggtg
cccaccaccgagctccatgaacaggtgaccctgagctatggcatgtttgaaaacaagcgg
aacgccgtgcacatcaagggacccttctcagtggaggctgacccttccaggttccgctct
atccactgccatctgtacccggacacaccctggtgtccccgcactgccatcctctag

DBGET integrated database retrieval system