KEGG   Rattus norvegicus (rat): 170908
Entry
170908            CDS       T01003                                 

Gene name
Tesk2
Definition
(RefSeq) dual specificity testis-specific protein kinase 2
  KO
K08842  testis-specific kinase 2 [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    170908 (Tesk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     170908 (Tesk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   170908 (Tesk2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 170908
NCBI-ProteinID: NP_596887
RGD: 619984
Ensembl: ENSRNOG00000017282
UniProt: Q924U5
Position
5
AA seq 570 aa
MDRSKRNSIAGFPPRVERLEEFEGGGGGDGNTVQVGRVSSSSYRAIISAFSRLTSLDDFT
REKIGSGFFSEVFKVRHRASGQVMALKMNTLSSNRANLLKEMQLMNRLSHPNILRFMGVC
VHQGQLHALTEYINSGNLEQLLDSNLYLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSK
NCLIKRDENGYSAVVADFGLAEKIPDASIGSEKLAVVGSPFWMAPEVLRDEPYNEKADVF
SYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPSDFLQLTFNCCNMDPKLRP
SFEEIGKTLEEIMSRLQEEELERDRKLQPTAKGLLEKVPGGKRLSSLDDKIPHKSPRPRR
TIWLSRSQSDIFSRKPPRTVNVLDPYYQPRDGATHTPKVNPFSARQDLKGGKVKFFDLPS
KSVISLVFDLDAPGPGTVSLADCQEPLAPSSRRWRSLPGSPEFLHQACPFVGCEESLSDG
PPPRLSSLKYRVREIPPFRTSALSATSAHEAMDCSNPQEENGFVPRPKGTSPCSGAASEE
MEVEEERPRRAPVHFSISGISLQTQGEQDG
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggatcggagcaaacggaactcgatcgcagggtttcccccgcgtgtggagcgtctggaa
gaatttgaaggaggcggtggaggggatgggaacactgtgcaggtgggaagagtttcgtca
tcttcatatcgtgcgattatcagtgccttttccagactgacgagtttggatgacttcacc
cgtgaaaaaataggatctgggttcttctccgaggttttcaaggttcggcacagagcttca
gggcaggtgatggctctcaagatgaacacgctgagcagtaaccgagcaaacctgctgaag
gagatgcagctcatgaacagactgtcccatcccaacatcctcaggttcatgggtgtgtgt
gtacatcaaggacagttgcatgcacttacagagtacatcaactctgggaacctggagcag
ctgctagacagtaacctgtatttgccttggactgtgagagtgaaactggcctatgacata
gcagtggggctcagctaccttcacttcaaaggcattttccaccgggacctcacgtcgaag
aactgccttataaagagagatgaaaacggttactctgcggtggtagctgatttcggcctg
gctgagaagattcctgatgctagtatagggagtgagaagctagctgtggtgggctcacct
ttctggatggcacctgaggttctccgagatgaaccttacaatgagaaggcagacgtgttc
tcttacggtatcatcctctgcgagatcatcgcccgcatccaggctgatccggactatctt
ccccgcacagagaatttcgggctggattatgatgctttccagcacatggtgggagactgc
ccctcagacttcctgcaactcaccttcaactgctgtaatatggaccccaaactgcgccca
tcctttgaggagattgggaagaccctagaggaaattatgagccgcttacaggaagaagag
ttggagagagacaggaagctgcagcccacagctaaaggactattggagaaagtgcccgga
gggaagcgactgagttcactggatgacaagattccccacaagtctccacgtccaagacgt
actatctggttgtctcgaagccagtcagacattttctctcgtaagcccccacgtacagtc
aatgtcttggacccctattaccagccacgagatggtgctacacataccccaaaagtcaac
cctttcagtgcacgccaagacctcaagggtgggaaggtcaaattctttgacctacccagc
aaatctgttatttcccttgtatttgacctggatgcaccagggcctggaactgtatctcta
gctgactgtcaggagcctttggccccatcttccagacggtggcggtctttgcctggttca
cccgagttcttgcatcaggcttgtccatttgtggggtgtgaagaatcactgtctgatggg
cctccaccacgactcagtagtctcaagtacagagtaagagagatcccaccattccggaca
tctgccctatcagctacttcagcccatgaggccatggattgctctaacccccaagaagaa
aacggttttgttcccaggcctaaggggaccagcccatgcagtggggctgcctctgaggag
atggaggtggaggaagaaaggccacgaagagctcctgtccacttctctatctctggaata
agcttgcaaacccagggagagcaggacgggtga

DBGET integrated database retrieval system