KEGG   Rattus norvegicus (rat): 170909Help
Entry
170909            CDS       T01003                                 

Gene name
Erg
Definition
(RefSeq) ERG, ETS transcription factor
  KO
K09435  transcriptional regulator ERG
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05202  Transcriptional misregulation in cancer
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    170909 (Erg)
  09162 Cancer: specific types
   05215 Prostate cancer
    170909 (Erg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    170909 (Erg)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    170909 (Erg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT SAM_3 Pex14_N SAM_2 Arb2
Motif
Other DBs
NCBI-GeneID: 170909
NCBI-ProteinID: NP_596888
RGD: 621108
Ensembl: ENSRNOG00000001652
UniProt: Q91XV5
Position
11q11
AA seq 455 aa AA seqDB search
MASTIKEALSVVSKDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQP
PARVTIKMECNPSQVNGSRNSPDECSVTKGGKMVGSPDTVGMSYGSYMEEKHMPPPNMTT
NERRVIVPADPTLWSTDHVRQWLEWAVKEYGLLDVDVLLFQNIDGKELCKMTKDDFQRLT
PSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPYEPPRRSTWTGHS
HPTPQSKAAQPSPSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDS
SNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGK
RYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHTHPQKMNFVAPHPPALPVTSSS
FFATPNPYWNSPTGGIYPNTRLPASHMPSHLGTYY
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggccagcactattaaggaggccttgtcagttgtgagcaaggaccagtcactatttgag
tgtgcctacggaacgccacacctggctaagacagaaatgaccgcatcctcttccagtgac
tatggccagacatccaagatgagtcccagagtcccacaacaggactggctgtctcagccc
ccagccagggtcaccatcaagatggagtgcaaccctagccaggtgaacggttccaggaac
tcacctgacgaatgcagtgtgaccaaaggtgggaagatggtgggcagccctgatactgtg
ggaatgagctacggcagctacatggaggagaagcacatgccgccccccaatatgaccacg
aatgaacgcagagtgatcgtccctgcagatcctactctgtggagcacagaccatgtccgg
cagtggctggagtgggcagtgaaagaatacggcctcctagacgtggacgtcttattattt
cagaatattgacgggaaggagctgtgcaagatgacaaaagatgacttccagaggctcact
ccgagctacaatgccgacattcttctctcacatctccactacctcagagagactcccctt
ccacatctgacatccgacgacgttgataaggctttacaaaactctccacggttaatgcat
gctagaaacacagatttaccttatgagcctcccaggagatcaacctggaccggccacagc
caccccacccctcagtccaaagctgcccagccatctccctccacagtgcccaaaactgaa
gaccagcgtcctcagttagatccttaccagatcctgggacccaccagtagtcgccttgct
aatccaggtagtggccagatccagctgtggcagttcctgctagaactcctgtctgacagc
tccaactccaactgcatcacctgggaaggcaccaacggggagttcaagatgacagacccg
gatgaggtggctcggcgctggggggagcggaagagcaagcccaacatgaactatgacaaa
ctcagccgtgccctccgctactactacgacaaaaacatcatgaccaaggtgcacgggaag
cgctatgcctacaagtttgacttccacgggattgcccaggccctgcagccccatcccccc
gagtcgtccctgtacaagtacccctccgacctgccgtacatgggctcctatcacacccac
ccccagaagatgaactttgtggctccccaccctccggccctcccagtcacatcttccagt
ttctttgctaccccgaacccatactggaattcgccgactgggggcatctacccgaacact
aggctcccagccagccatatgccctctcacctgggcacctactactag

DBGET integrated database retrieval system