KEGG   Rattus norvegicus (rat): 170912Help
Entry
170912            CDS       T01003                                 

Gene name
A1cf, A1cft, Acf, Apobec-1
Definition
(RefSeq) APOBEC1 complementation factor
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 DND1_DSRM PHM7_cyt RRM_5 RRM_7 Limkain-b1 BRAP2 dsrm HEPN_AbiU2
Motif
Other DBs
NCBI-GeneID: 170912
NCBI-ProteinID: NP_596891
RGD: 619834
Ensembl: ENSRNOG00000033195
UniProt: Q923K9
Position
1q52
AA seq 586 aa AA seqDB search
MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDTTPPERGCEIFI
GKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKQEAKNAIKQLNNYE
IRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRG
FAFVEYESHRAAAMARRRLLPGRIQLWGHPIAVDWAEPEVEVDEDTMSSVKILYVRNLML
STSEEMIEKEFNSIKPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTL
AKPVDKDSYVRYTRGTGGRNTMLQEYTYPLSHVYDPTTTYLGAPVFYTPQAYAAIPSLHF
PATKGHLSNRALIRTPSVRGAAGVRGLGGRGYLAYTGLGRGYQVKGDKRQDKLYDLLPGM
ELTPMNTISLKPQGVKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFLYKVTIPALA
SQNPAIHPFTPPKLSAYVDEAKRYAAEHTLQTLGIPTEGGDAGTTAPTATSATVFPGYAV
PSATAPVSTAQLKQAVTLGQDLAAYTTYEVYPTFAVTTRGDGYGTF
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaaatcacaaatccggggatggattgagcggcacccagaaggaagcagcactc
cgcgcactggtccagcgcacaggatatagcttggtccaggaaaatggacaaagaaaatat
ggtggtcctccaccaggctgggatactacacccccagaaaggggctgcgagattttcatt
gggaaacttccccgggacctttttgaggatgaactcataccattgtgtgaaaaaattggt
aaaatttatgaaatgagaatgatgatggatttcaatgggaacaacagaggctatgcattt
gtaaccttctcaaataagcaggaagccaagaatgcaatcaagcaacttaataattatgaa
attcggaatggccgtctcctgggcgtctgtgccagtgtggacaactgccggttgtttgtg
gggggaatccccaaaaccaaaaagagagaagaaatcttgtcagagatgaaaaaggtcact
gaaggagttgttgatgtcattgtctacccaagcgctgccgataaaaccaaaaaccggggg
tttgcctttgtggaatatgagagtcaccgcgcagccgccatggctaggcggaggctgctg
ccaggaagaattcagttgtggggacatcctatcgcagtagactgggcagagccagaagtc
gaagttgacgaagacacaatgtcttccgtgaaaatcctgtacgtaaggaaccttatgctg
tctacctcggaagagatgattgagaaggaattcaacagtattaaaccaggtgctgtggaa
cgggtgaagaagatccgagactatgcttttgtgcatttcagtaaccgagaagatgcagtt
gaagccatgaaggctttgaatggcaaggtgctggatggttccccaatagaagtgaccttg
gccaagccagtggacaaggacagttacgttaggtacacccggggcaccgggggcaggaac
accatgctgcaagaatacacctaccctctgagccatgtttatgaccctaccacaacctac
cttggagctcctgtcttctatactccccaagcctacgcagccattccaagtcttcatttc
ccagctaccaaaggacatctcagcaacagagctctcatccggaccccttctgtcagaggg
gctgcgggcgtgagaggactgggcggccgtgggtatttggcatatacaggcctgggtcga
ggataccaggtcaaaggagacaagagacaagacaaactctatgaccttctgcctgggatg
gagctcaccccgatgaatactatctctttaaaaccacaaggagttaaacttgctcctcag
atattagaagaaatctgtcagaaaaataactggggacagccagtgtaccagctgcactct
gccattggacaagaccaaagacagttattcctatacaaagtaactatcccagcgctggcc
agccagaatcctgcgatccaccctttcacacccccaaagctaagcgcctacgtggatgaa
gcaaagaggtacgccgcagagcacaccctacagacactaggcatccccacagaaggaggg
gacgctgggactacagcacccactgccacatccgccactgtgtttccaggatacgctgtc
cccagtgccaccgctcctgtgtctacagcccagctcaagcaagcagtgacacttggacaa
gacttagcagcatatacaacctatgaggtctaccctacttttgcagtgaccacccgaggt
gatggatatggcaccttctga

DBGET integrated database retrieval system