KEGG   Rattus norvegicus (rat): 170917
Entry
170917            CDS       T01003                                 

Gene name
Cry2
Definition
(RefSeq) cryptochrome-2
  KO
K02295  cryptochrome
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    170917 (Cry2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    170917 (Cry2)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    170917 (Cry2)
SSDB
Motif
Pfam: FAD_binding_7 DNA_photolyase Peripla_BP_6 ROQ_II
Other DBs
NCBI-GeneID: 170917
NCBI-ProteinID: NP_596896
RGD: 620935
Ensembl: ENSRNOG00000007478
UniProt: B2GUU9
Position
3
AA seq 594 aa
MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFA
ASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDS
EPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMEL
PKKPVGAVSSQHMENCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLD
KHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYRKVKRNSTP
PLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDA
IMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSC
SAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCII
GVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPGSSQA
GSISNTGPRPLSSGPASPKRKLEAAEEPPGEELSKRARVTVTQMPAQEPPSKDS
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggcggcggctgctgtggtggcagcgacggtccccgcgcagtcgatgggcgcggacggc
gcgtcctccgtgcactggttccgcaaaggactacggctccacgacaaccccgcgctgtta
gctgccgtgcgcggggcgcgctgtgtgcgctgcgtctacatcctcgacccgtggttcgcg
gcctcctcgtcagtgggcatcaaccgatggaggttcctactgcagtctctagaagatctg
gacacaagcttaagaaagctgaattcccgtctgtttgtagtccggggtcagccagctgat
gtgttcccaaggcttttcaaggaatggggggtgacccgcttgacctttgaatatgactcc
gaaccctttgggaaagaacgggatgcagccattatgaagatggccaaggaggcgggtgtg
gaggtggtgactgagaactctcacaccctttatgacttagacagaatcatcgaactgaat
gggcagaaaccaccccttacctacaagcgctttcaggctctcatcagccgtatggagctg
cccaagaagccagtgggggctgtgagcagccagcatatggagaactgcagagctgagatc
caggagaaccatgatgacacctatggcgtgccttccttagaggaactgggattccccaca
gaaggacttggcccagctgtttggcaaggaggagagacagaagctctggcccgcctggat
aagcacttggaacggaaggcctgggttgccaactatgagagacctcggatgaatgccaat
tccttgctggccagccccacaggcctcagcccctacctgcgctttggctgcctctcctgc
cgcctcttctactaccgcctgtgggacttgtacagaaaggtgaagaggaacagcacaccc
cccctctccttatttggacaactcctatggcgagaattcttctatacagcggccaccaac
aaccccaggtttgaccgaatggaggggaaccccatctgcatccagatcccctgggaccgc
aaccccgaagccctggccaagtgggccgagggcaagacaggcttcccttggattgacgcc
atcatgacccaactgaggcaggagggctggatccaccacctggcccggcacgctgtggcc
tgcttcctcacccgaggggacctctgggtcagctgggagagcggggtccgggtatttgat
gagttgctcctggatgcagatttcagcgtgaatgcaggcagctggatgtggctgtcctgc
agtgctttcttccaacagttcttccactgctactgccctgtgggctttggccgacgcacg
gaccccagtggggactacatccggcgatacctgcccaaactgaaaggcttcccctctcga
tatatctatgagccctggaatgctcccgagtcggttcagaaggccgctaagtgcatcatt
ggcgtggactacccacggcccatcgtcaaccacgcagagactagtcggctcaacattgag
cggatgaagcagatctaccaacagctgtcacgataccgggggctctgtctgttggcatct
gtcccttcctgtgtagaagacctcagtcaccctgtggcagagcctggttctagccaggct
gggagcatcagcaacacaggccccagaccactgtccagtggcccagcctcccccaaacgc
aagctggaagcagctgaggaacctccaggtgaagaactgagcaagcgggctagagtgaca
gtgactcagatgcctgcccaggagccaccaagcaaggactcctga

DBGET integrated database retrieval system