KEGG   Rattus norvegicus (rat): 170920
Entry
170920            CDS       T01003                                 

Gene name
Map4k3
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 3
  KO
K04406  mitogen-activated protein kinase kinase kinase kinase 3 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    170920 (Map4k3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    170920 (Map4k3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     170920 (Map4k3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   170920 (Map4k3)
SSDB
Motif
Pfam: Pkinase CNH PK_Tyr_Ser-Thr Pkinase_fungal Haspin_kinase
Other DBs
NCBI-GeneID: 170920
NCBI-ProteinID: NP_596898
RGD: 621280
Ensembl: ENSRNOG00000007172
UniProt: Q924I2
Position
6q11
AA seq 873 aa
MNPGFDLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQ
EIIMMKDCKHANIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVTGPLSELQIAYVSRET
LQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAP
EVAAVERKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKL
KWSNSFHHFVKMALTKNPKKRPTAEKLLQHPFVTQPLTRSLAIELLDKVNNPDHSTYHDF
DDDDPEPLVAVPHRIPSTSRNVREEKTRSEINFGQVKFDPPLRKETEPHHELDLQLEYGQ
GHQSNYFLGGNKSLLKSVEEELHQRGHVAHLEDDEGDDDDSKHSTLKAKVPPPLPPKPKS
ISIPQDTHSSEDSNQGTIKRCPSSGSPAKPSHVPPRPPPPRLPPQKPAVLGNGVSSFQLN
GERDGSVHQQQSEQRGTNLSRKEKKDVPKPISNGLPPTPKVHMGACFSKVFNGCPLKIHC
ATSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLFPRRCTWLYVMNNCLLSVSGKA
SQLYSHNLPGLFDYARQMQKLPVAIPAHKLPDRILPRKFAVSAKIPETKWCQKCCVVRNP
YTGHKYLCGALQTSIVLLEWVEPMQKFMLIKHIEFPMPCPLRMFEMLVVPEQEYPLVCVG
VSRGRDFNQVVRFETVNPNSTSSWFTESDTPQTNVTHVTQLERDTILVCLDCCIKIVNLQ
GRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQEISDNTRIFRL
LGSDRVVVLESRPTDNPTANSNLYILAGHENSY
NT seq 2622 nt   +upstreamnt  +downstreamnt
atgaacccgggcttcgacctgtcccgccggaacccgcaggaggacttcgagctgatccaa
cgcataggcagcggcacctacggcgacgtctacaaggcacggaatgtcaacactggagaa
ttagccgcaattaaagtgataaaattggaaccaggagaagacttcgcggttgtacagcaa
gaaatcattatgatgaaagactgcaaacatgcaaacatcgttgcttattttggaagttat
ctcaggcgagataaactttggatttgcatggaattttgtggaggtggctctttacaggac
atctatcatgtaactggccccctttcagagctgcagattgcatacgttagcagggaaaca
ctccagggattgtattaccttcacagtaaaggaaaaatgcacagagatataaagggcgct
aacatcctactaacggataacggtcatgtgaaattagctgattttggagtttccgcacag
ataacagctacaattgccaaacggaagtccttcattggtaccccatattggatggcccca
gaagtcgcggctgttgagcggaaaggagggtacaatcagctgtgtgacctctgggctgtg
ggcatcactgccatcgagctggcggagctccagccacccatgtttgaccttcacccaatg
agggcattgtttctaatgacaaaaagcaatttccagcctcctaaattaaaagataagttg
aagtggtcaaatagtttccatcattttgtgaagatggctcttaccaaaaatccaaaaaaa
agacccactgcagaaaagctgctacagcatccctttgtcacacagcctctgacgaggtct
ttggcaatcgagttgctggacaaggtgaataatccagatcattccacataccacgacttt
gacgatgatgacccagagcctcttgttgctgtaccacatagaattccttcaactagtagg
aatgtgagagaagaaaagacacgctcagagataaactttggtcaggtaaaatttgacccg
cccttaaggaaggagacagagccgcatcatgaacttgatctacaattagagtacgggcaa
ggacaccaaagtaattactttttaggtggaaacaagagtcttctgaagtctgttgaagag
gagctgcaccagcgaggacacgtggcacacttagaagatgacgaaggggacgatgacgac
tctaaacattcaaccttgaaagcaaaagtcccacctcctctgccaccaaagcctaaatcc
atctccataccacaggatacacattcttctgaggacagtaatcaaggcacaatcaagaga
tgtccctcatcagggagcccagcaaagccatcccacgttcctcctagaccaccacccccc
aggctacccccgcagaagcctgctgttttaggcaatggggtgagctccttccagctcaat
ggtgaacgggacgggtcggtgcatcagcagcagagtgagcagagaggcacgaacctctcc
agaaaagagaagaaggacgtgccaaagccaattagtaatggccttcccccaacacctaaa
gtgcatatgggagcatgtttttcaaaggtttttaatggatgtcccttgaaaatccactgt
gccacatcttggataaatccggacacgagagaccagtacttgatatttggcgctgaagag
ggcatttatacccttaatctcaatgaacttcatgaaacatcaatggaacagctgttcccc
cgcaggtgtacgtggttgtatgtaatgaacaactgcttactgtccgtatccggcaaagcc
tctcagctttattcccacaatttaccagggcttttcgattatgcaagacagatgcagaag
ttacctgtagccatcccagcacacaagctcccggatcgaatactgcccaggaaatttgct
gtatcagcaaagattcctgaaaccaagtggtgtcagaagtgctgcgtggtgagaaatcct
tacacgggccataagtacctgtgcggagcacttcagactagcattgttctattagaatgg
gttgagccaatgcagaagtttatgttaattaagcacatagagtttccaatgccgtgtccg
ctccggatgttcgagatgctggtggtgccagagcaggagtaccctctggtctgtgttggc
gtcagtagagggcgagacttcaaccaagtggtgcgatttgagaccgtcaatccaaattct
acctcgtcatggttcacagagtcagataccccgcagacaaacgtcacccatgtgacccag
ctggagagagacaccatcctcgtgtgcttggattgttgtataaaaatagtgaatctccaa
ggaagattgaaatccagcagaaaattatcttcagagctcaccttcgatttccagatagaa
tccatagtttgtctacaagacagtgtgctagctttctggaaacacgggatgcaaggtaga
agttttagatctaacgaggtaacacaagaaatttcagataacacaagaatcttcagactt
cttggatctgacagggttgtggttttggaaagtagaccaactgacaacccaacagcaaat
agcaatttatacatcctggcgggccacgaaaacagctactga

DBGET integrated database retrieval system