KEGG   Rattus norvegicus (rat): 170928
Entry
170928            CDS       T01003                                 

Gene name
Necab2, Efcbp2
Definition
(RefSeq) N-terminal EF-hand calcium binding protein 2
  KO
K23854   
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: ABM EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7 EF-hand_5 SPARC_Ca_bdg HAUS-augmin3 Sec23_helical DUF5790 EF-hand_10
Other DBs
NCBI-GeneID: 170928
NCBI-ProteinID: NP_596906
RGD: 621844
Ensembl: ENSRNOG00000015084
UniProt: F1LQY6
Position
19q12
AA seq 352 aa
MGEPRAPLVPDIPAADPDPGPAAPRGGTAVILDIFRRADKNDDGKLSLEEFQLFFADGVL
NEKELEGLFHTIDSDNTNHVDTKELCDYFVEHMGDYEDVLASLETLNHSVLKAMGYTKKV
YEGGNNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQIRQDYCKPSHGVNESRY
GGPTPPYIPNHKLVVPEPVKSLPVAIGEPKEEGLEVQISRLAELIGRLESKTLSFDLQQR
LSDEEGTNMYLQLVRQEMAVCPEQLGEFLDSLRQYLRSTAEEKNCFHVAAVRMADGLTFV
IYEFWETEEEWKKHLQSPVCKGFRHVKVDTLSQPEALSQISVPAAWCTSGRD
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgggggaaccccgcgcaccgctcgtccccgacatccccgccgcggaccccgaccccggg
cccgccgcaccgcgagggggcacagccgtcatcctggacattttccgccgtgcggataaa
aacgacgacgggaaactgtcccttgaggaatttcaactgttcttcgcggatggcgtcctc
aatgagaaggagctggagggcctcttccacaccattgattcagacaacaccaaccatgtg
gacacaaaggaattgtgtgattactttgtggaacacatgggagactacgaagatgtcctg
gcctccctcgagactttgaaccactcagtcctgaaggctatgggctacaccaagaaggtg
tatgaaggtgggaacaacgtggaccagtttgtgacccgcttccttctgaaggagacggcc
aatcagatccagtcgctgctcagctctgtggaaagcgccgtggaagccatcgaagaacag
accagccagatccgacaggactactgcaaacctagtcatggcgtcaacgagagccgctac
ggaggacccactcctccctacatccccaaccacaagcttgtggtcccggaaccagtgaag
agcctgcctgtggccataggggagccaaaggaggaggggctggaggtccagataagccgg
ttggcagagctgattgggagactggagagcaagaccctctcgtttgacctgcagcagcgc
ctctcggatgaagaaggcaccaacatgtacctgcagctggtccggcaggagatggccgtg
tgccctgagcagctgggcgagttcttggattccctgagacagtaccttcggagcactgct
gaagaaaagaactgcttccatgtggccgcggtgaggatggcagatgggctaaccttcgtc
atctacgagttctgggagacagaggaggagtggaagaagcacctgcagagccctgtgtgc
aagggcttccgacatgtcaaggttgacacactgagccagcctgaggcactctcccagatc
tccgtgccagctgcctggtgcacctccggccgagactga

DBGET integrated database retrieval system