KEGG   Rattus norvegicus (rat): 170929Help
Entry
170929            CDS       T01003                                 

Gene name
Bcl2a1, Bcl2a1d
Definition
(RefSeq) BCL2-related protein A1
  KO
K02162  hematopoietic Bcl-2-related protein A1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04210  Apoptosis
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    170929 (Bcl2a1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    170929 (Bcl2a1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    170929 (Bcl2a1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    170929 (Bcl2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2
Motif
Other DBs
NCBI-GeneID: 170929
NCBI-ProteinID: NP_596907
RGD: 620621
Ensembl: ENSRNOG00000047606
UniProt: Q925A9
Position
8q31
AA seq 175 aa AA seqDB search
MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSRVLQRVAFSVQKEVEKNLKPYLDDFH
VESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIGLDVDTYKQVSS
FVAEFIMNNTGEWIQQNGGWEDGFTKKFEPKSGWLTFLQMTGKIWEMLFLLKQHY
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgacagactgtgagttcatgtatatccactccctggctgagaactatcttcagtatgtc
ctgcaggtacctgcctttgaatcggctccaagcaaaacgtccagagtgctacagagagtt
gctttctctgtacaaaaggaagttgaaaagaatctgaagccatacttggatgactttcac
gtggaatccatagatactgccagaataatattcaaccaagtgatggaaaaagaatttgaa
gatggcatcattaactggggaaggattgtgactatatttgcctttgggggtgttctcctg
aaaaagcttccacaagagcagattggcctggatgtggatacttacaagcaagtttccagt
tttgtggcggaattcataatgaataacacaggagaatggatacagcagaatggaggctgg
gaagatggcttcacaaagaagtttgaacctaaatctggctggctgacttttctgcagatg
acagggaagatctgggaaatgctctttctcctcaagcaacactactga

DBGET integrated database retrieval system