KEGG   Rattus norvegicus (rat): 170943
Entry
170943            CDS       T01003                                 

Gene name
Slc25a10
Definition
(RefSeq) mitochondrial dicarboxylate carrier
  KO
K13577  solute carrier family 25 (mitochondrial dicarboxylate transporter), member 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04964  Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    170943 (Slc25a10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    170943 (Slc25a10)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   170943 (Slc25a10)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 170943
NCBI-ProteinID: NP_596909
RGD: 621430
Ensembl: ENSRNOG00000036693
UniProt: O89035
Position
10
AA seq 286 aa
MAEARTSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALQVVRTDGFLALY
NGLSASLCRQMTYSLTRFAIYETMRDYMTKDSQGPLPFYSKVLLGGISGLTGGFVGTPAD
LVNVRMQNDMKLPLSQRRNYSHALDGLYRVAREEGLKKLFSGATMASSRGALVTVGQLSC
YDQAKQLVLSTGYLSDNIFTHFLSSFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHCA
VETAKLGPQAFFKGLVPAGVRLVPHTVLTFMFLEQLRKHFGIKVAT
NT seq 861 nt   +upstreamnt  +downstreamnt
atggctgaggcacgcacgtctcgctggtactttggagggctggcttcctgcggagctgcc
tgctgcacgcaccctctagacctgctcaaggtgcatttgcagacccaacaggaggtgaag
cttcgaatgactggaatggcactgcaggtggtgcgaaccgatggcttcctggcactctac
aatggcctgagtgcctcgctgtgcaggcagatgacctactccctgacccggttcgctatc
tacgagaccatgcgggactacatgaccaaggacagccaggggcctctccccttctacagc
aaggtgttgctgggcggcatcagtggtttaactggaggcttcgtggggaccccagcagat
ttggtcaatgtcaggatgcagaatgacatgaagctgcccctgagccagcgccgcaactac
tctcacgccctggatggtctgtaccgtgtagcccgtgaagaaggcctgaagaagctcttc
tctggagcaaccatggcatccagccgtggggccctcgtcactgtgggccagctgtcctgc
tacgaccaggccaagcagctggttctcagtactgggtacctgagtgacaacattttcacc
cacttcctctccagtttcattgcgggcggatgtgccacatttctctgccagcccctggac
gtgctgaagactcgcttgatgaactccaagggcgagtatcagggtgttttccattgtgcc
gtggagacagcaaagcttggaccacaggcctttttcaagggtctcgttcctgcgggcgtc
cgtctcgtcccccacaccgtgcttaccttcatgttcctggagcagctgcggaagcacttc
ggtatcaaagtggcaacctga

DBGET integrated database retrieval system